DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and E02C12.8

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001379850.1 Gene:E02C12.8 / 179320 WormBaseID:WBGene00017093 Length:141 Species:Caenorhabditis elegans


Alignment Length:112 Identity:21/112 - (18%)
Similarity:43/112 - (38%) Gaps:34/112 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTNQYEENAEHLRQLFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELA--- 89
            |.|:...|...|:...|:          |||..     .::.::       :.||:...:.|   
 Worm    35 GENKRATNISDLKGFMSR----------IACLE-----PDWQNI-------EEGKELPSKFALKI 77

  Fly    90 GSEIVTVIVKR-----QIASLSRRQLYR----CEEAFSNEINAYRHL 127
            .|::..|.:.:     :.|..|..:|.:    .:|..:.|::||:.|
 Worm    78 SSQLALVALSKIMNFEEGAGFSEEKLKKFSSLTKECHNREVDAYKVL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 13/75 (17%)
P-loop_NTPase <357..435 CDD:304359
E02C12.8NP_001379850.1 PKc_like 3..>141 CDD:419665 21/112 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.