DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and F59B1.8

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:284 Identity:57/284 - (20%)
Similarity:104/284 - (36%) Gaps:60/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CEEAFSNEI---NAYRHLAPLLAAHSRHQLFPVCHIAESQDRRDAEGGEPIIVLQDLKAMGFRMK 174
            |::..:.|:   .|:.||..|        |.|....::..:             :|....||...
 Worm   117 CQKGHNLEVEFCEAFGHLEGL--------LLPKVFFSQKFE-------------EDNPNKGFVGM 160

  Fly   175 DRLAGLELSDCL---------LVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDEATDFY 230
            :.:.|..:..|.         .::|.||:|.|.||:.:...:               .|....|.
 Worm   161 EFVEGSVVRHCYENVTVDELQPILKALARLQALSLSTESCRN---------------LDNGEAFE 210

  Fly   231 ATILDTSVQQALESLGD--ANADDCLTTPIRLLEELRTNLFENLKH--EINATAAAPNSVICHGD 291
            .:::|...:..|:.:.|  .|.|..|:..:..:|:....:. ||:.  .:|........||||||
 Worm   211 ESLMDMLSEDGLKGIFDQSRNIDQKLSEKVERIEQNHKEIL-NLETVLNLNKVVGIDQKVICHGD 274

  Fly   292 LWVNNIMFRSEPEEVI---FFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSE 353
            ||..||::.......|   ..|.|.....:|..|::..:.::.....|..|.:.:|..:....::
 Worm   275 LWAANILWTQTDGGFIADKVLDYQESHMGNPAEDLVRLLVSTISGADRQSHWEHILEQFYTYFTD 339

  Fly   354 ELRHQLEDTTAAERLEELCEAFSL 377
            |    :....|...||:|..:|.|
 Worm   340 E----IGSNNAPYTLEQLKTSFKL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 51/262 (19%)
P-loop_NTPase <357..435 CDD:304359 6/21 (29%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 57/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.