DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pix and ABCE3

DIOPT Version :9

Sequence 1:NP_648272.1 Gene:pix / 39027 FlyBaseID:FBgn0086706 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_194759.1 Gene:ABCE3 / 829153 AraportID:AT4G30300 Length:181 Species:Arabidopsis thaliana


Alignment Length:175 Identity:103/175 - (58%)
Similarity:131/175 - (74%) Gaps:6/175 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 MVKTLGKFELTVEKGHFSDSEILVLLGENGTGKTTFIRMLAGN-LQPDGE----VELPMLNISYK 420
            |..|.|.|:|.:.:|.|:||:|:|:||||||||||||:||||: |..|.|    .|:|..::|||
plant     1 MTITRGDFKLRLNQGEFTDSQIIVMLGENGTGKTTFIKMLAGSKLDIDEEGSQVHEIPQFSVSYK 65

  Fly   421 PQKIS-PKFQNHVRHLLHDKIRDAYVHPQFIADVMKPMKIEEIMDQEVQNLSGGELQRVALVLCL 484
            .|.:| .||:..||.|:|.||.:||...||::|||||:||||:||:....|||||.|||||.|||
plant    66 NQHMSNRKFEITVRDLIHRKIPNAYAEHQFVSDVMKPLKIEELMDKSFNKLSGGEKQRVALALCL 130

  Fly   485 GKPADVYLIDEPSAYLDSEQRLVAAKVIKRYILHAKKTGFVVEHD 529
            ||.||:||||||||:||||||::|:|||||:||..||..|...|:
plant   131 GKSADIYLIDEPSAFLDSEQRIIASKVIKRFILQMKKAAFARFHN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pixNP_648272.1 Rli1 12..605 CDD:224166 103/175 (59%)
ABCE3NP_194759.1 P-loop_NTPase 1..>177 CDD:422963 103/175 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1245
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359213at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.