DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pix and Abce1

DIOPT Version :10

Sequence 1:NP_648272.1 Gene:pix / 39027 FlyBaseID:FBgn0086706 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_056566.2 Gene:Abce1 / 24015 MGIID:1195458 Length:599 Species:Mus musculus


Alignment Length:98 Identity:19/98 - (19%)
Similarity:36/98 - (36%) Gaps:35/98 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 KRPDTFGLGEETKQSGVLKKSETFSDRTNCYQSLPPPPPPLVKVKK---VKVSRSRDEL--NRKV 280
            :||   |.|::|:..|                      ||.:..:.   :.|:|::..:  |.|.
Mouse    14 ERP---GSGDDTRAWG----------------------PPFLGEESAYFLSVNRNKKSIAVNLKY 53

  Fly   281 EAFIKKCND-ERFASMKLDN----EVARHGLSY 308
            ...||...: .:...:.|:|    ::...||.|
Mouse    54 PKGIKVVTELAKICDVLLENYLPGKLGEMGLGY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pixNP_648272.1 Rli1 14..606 CDD:440858 19/98 (19%)
Abce1NP_056566.2 Rli1 6..598 CDD:440858 19/98 (19%)

Return to query results.
Submit another query.