DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5026 and MTM2

DIOPT Version :9

Sequence 1:NP_001163392.1 Gene:CG5026 / 39026 FlyBaseID:FBgn0035945 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_196074.2 Gene:MTM2 / 830333 AraportID:AT5G04540 Length:833 Species:Arabidopsis thaliana


Alignment Length:492 Identity:137/492 - (27%)
Similarity:226/492 - (45%) Gaps:98/492 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 WRITNVNRDFSVCATYGATLIVPKAITDEQIVLSAAFRDGGRFPVLSYRHE-NGATLMRSSQPL- 276
            |||||:|.::.:|.:|...|:|||:|:||:::.::.||...|.||:|:.|. :||.:.|||||| 
plant   219 WRITNLNSNYDLCQSYPFALMVPKSISDEELLQTSTFRARCRLPVISWCHPGSGAVIARSSQPLV 283

  Fly   277 SIQGIKRCRADEAILNLVL-------GRSRKGFIVD---------TWGKGKSNTETDLHYSQWKK 325
            .:....|..:||.::....       |..||.:|||         ...|| ..:|:..:|.|.:.
plant   284 GLMMNMRSNSDEKLVASFCTQLAGHKGARRKLYIVDARPRKNALANGAKG-GGSESSSNYLQSEI 347

  Fly   326 VNRSIGNVSSPASILDSFARLIEACNDLGCSTD------------KW-----------LSRLENS 367
            |...|.|:.   ::.:||:||.:..:..|.::.            .|           :|.|.:|
plant   348 VFLGIDNIH---AMRESFSRLRDYLDMHGTTSSDGTSSFLRHGGWTWGGGNLSSMSASVSVLGDS 409

  Fly   368 GWLSLVLNSLNASCVVAQCLDQEGSPVLVHGAKGLDSTLIVTSLVQIILNPDCRTVRGLQALIER 432
            ||||.:.:.|.....:|..:..|.:.||||.:.|.|.|..:.||..::|:|..||..|.|||:|:
plant   410 GWLSHIQSILAGVAWIAARVAMESASVLVHCSDGWDRTTQLVSLACLLLDPYYRTFSGFQALVEK 474

  Fly   433 EWIQAGHPFASRHRYSCYTPN---------------------------------QTRNKTSGAT- 463
            :|:..||||:.|    ...||                                 |:.:.:.|.. 
plant   475 DWLSFGHPFSDR----VGMPNVSESGNFELPIQSSSARSFPSSPVRQSPGSAAAQSSSSSYGLNN 535

  Fly   464 ----FVLFLDCIYQLYTQFPCSFEFSTQLLILLFEHSHFSQYGTFLCDSERERNELNVHTRTTSL 524
                |:.:||||.||...:|.:||||...|:...:.....::|.|||:||:||.:..:......:
plant   536 YSPIFLQWLDCISQLMRMYPSAFEFSPTFLVDFIDCLLSCRFGNFLCNSEKERQQCGISETCGCI 600

  Fly   525 WSYL----NRPDVLQTFLNPLYEPNA--NVIWPSVAPISLELWSDLYLRWVIDQRSSVT-VMSQI 582
            |:||    :.........||.|:|:.  ..:.|..|.::..||...:|||......:|| ...|.
plant   601 WAYLADLRSSSGTSHVHCNPFYDPSRYDGPLLPPAAALAPTLWPQFHLRWACPVEPNVTETEDQC 665

  Fly   583 QELVTREKELRTQALKLRKQAMELGQEVSNLMKSGND 619
            :.:..:..|::    |.:::|.....|:|:.|:|.|:
plant   666 RAMTVKYSEMK----KEKEEAERKVDELSSAMESLNE 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5026NP_001163392.1 PH-GRAM_MTMR9 1..106 CDD:275398
Myotub-related 117..511 CDD:284109 110/375 (29%)
MTM2NP_196074.2 GRAM 49..108 CDD:214725
Myotub-related 168..587 CDD:284109 110/375 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10807
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.