DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5026 and SBF1

DIOPT Version :9

Sequence 1:NP_001163392.1 Gene:CG5026 / 39026 FlyBaseID:FBgn0035945 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_011529011.1 Gene:SBF1 / 6305 HGNCID:10542 Length:1903 Species:Homo sapiens


Alignment Length:543 Identity:143/543 - (26%)
Similarity:212/543 - (39%) Gaps:172/543 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 STLTVGAGI-PHPLQNGYAIEALAC--GVGGVGGGALQS--PQASCE-WRITNVNRDFSVCATYG 230
            ||||..:.: |.......::...||  ....:|.|.|.|  .:|..| :||:.|||.:::|.:|.
Human  1112 STLTPSSALKPSDRMTMSSLVERACCRDYQRLGLGTLSSSLSRAKSEPFRISPVNRMYAICRSYP 1176

  Fly   231 ATLIVPKAITDEQIV-LSAAFRDGGRFPVLSYRH-ENGATLMRSS-----------------QPL 276
            ..||||:::.|..:. :|..:|. .||||:.:|. .:.|.|:||.                 .|.
Human  1177 GLLIVPQSVQDNALQRVSRCYRQ-NRFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFKAQNAPSPG 1240

  Fly   277 SIQGIKRCRADEAILNLVL----------GR---------------------------------S 298
            ..|........|..|..|:          ||                                 |
Human  1241 QSQADSSSLEQEKYLQAVVSSMPRYADASGRNTLSGFSSAHMGSHVPSPRARVTTLSNPMAASAS 1305

  Fly   299 RKGFIVDTWG----KGKSN-TETDL---------------------------------------- 318
            |:......||    .|:|: ..||:                                        
Human  1306 RRTAPRGKWGSVRTSGRSSGLGTDVGSRLAGRDALAPPQANGGPPDPGFLRPQRAALYILGDKAQ 1370

  Fly   319 -------HYSQWKKVNRSIGNVSSPASILD------SFARLIEACNDLGC-----STDKWLSRLE 365
                   ...||:.|         |..:.:      ||.:|::||.. ||     |...:|..||
Human  1371 LKGVRSDPLQQWELV---------PIEVFEARQVKASFKKLLKACVP-GCPAAEPSPASFLRSLE 1425

  Fly   366 NSGWLSLVLNSLNASCVVAQCLDQEGSPVLVHGAKGLDSTLIVTSLVQIILNPDCRTVRGLQALI 430
            :|.||..:...|..|.:|.:.|| .||.|||....|.|.|..|.||||::.:|..||:.|.:.|:
Human  1426 DSEWLIQIHKLLQVSVLVVELLD-SGSSVLVGLEDGWDITTQVVSLVQLLSDPFYRTLEGFRLLV 1489

  Fly   431 EREWIQAGHPFASRHRYSCYTPNQTRNKTSGAT--FVLFLDCIYQLYTQFPCSFEFSTQLLILLF 493
            |:||:..||.|:.|..::      ...::||.|  |:.||||::|::.|||..||||...|..|.
Human  1490 EKEWLSFGHRFSHRGAHT------LAGQSSGFTPVFLQFLDCVHQVHLQFPMEFEFSQFYLKFLG 1548

  Fly   494 EHSHFSQYGTFLCDSERERNELNV----------HTRTTSLWSYLNR-----PDVLQTFLNPLYE 543
            .|....::.|||.||:.||.||.:          .....|:|.|::|     |    .|.|.:|.
Human  1549 YHHVSRRFRTFLLDSDYERIELGLLYEEKGERRGQVPCRSVWEYVDRLSKRTP----VFHNYMYA 1609

  Fly   544 P-NANVIWPSVAPISLELWSDLY 565
            | :|.|:.|.....:|::| |.|
Human  1610 PEDAEVLRPYSNVSNLKVW-DFY 1631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5026NP_001163392.1 PH-GRAM_MTMR9 1..106 CDD:275398
Myotub-related 117..511 CDD:284109 123/471 (26%)
SBF1XP_011529011.1 uDENN 36..92 CDD:281455
DENN 139..320 CDD:214823
dDENN 374..442 CDD:129037
SBF2 553..774 CDD:289132
PH-GRAM_MTMR5 903..1021 CDD:275417
Myotub-related 1138..1566 CDD:284109 116/445 (26%)
PH_Sbf1_hMTMR5 1796..1901 CDD:269941
PH 1800..1901 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.