DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5026 and Sbf

DIOPT Version :9

Sequence 1:NP_001163392.1 Gene:CG5026 / 39026 FlyBaseID:FBgn0035945 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_477401.2 Gene:Sbf / 41427 FlyBaseID:FBgn0025802 Length:1993 Species:Drosophila melanogaster


Alignment Length:542 Identity:124/542 - (22%)
Similarity:204/542 - (37%) Gaps:151/542 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 WRITNVNRDFSVCATYGATLIVPKAITDEQIV-LSAAFRDGGRFPVLSYRHENGATLMRSSQPLS 277
            :||:|.|..::.|.:|.|.::.|...:|..|: |...|: |.|.|:.::||.|||.|:|..||.|
  Fly  1179 FRISNANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFK-GQRIPLPTWRHANGALLIRGGQPNS 1242

  Fly   278 IQGIKRCR------------------ADEAILNLV------------------------------ 294
            ...|...:                  .|:..|.|:                              
  Fly  1243 KSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLTPLALNQYSGMNLSMSSLMGHSSS 1307

  Fly   295 ---------LGRSRK-------GFIVDTWGKG---KSNTETDLHYSQWKKVNRSIGNVSSPASIL 340
                     |.|..|       |......|||   |.|.:..|.:...|....::|..|...|.:
  Fly  1308 DDRQPLTPELSRKHKNNLDISDGNKSSQGGKGGTMKGNPKNSLAHPFRKMRLYALGEKSQAKSNM 1372

  Fly   341 D--------------------SFARLIEAC----NDLGCSTDKWLSRLENSGWLSLVLNSLNASC 381
            :                    :|.:||.||    |........:...:|.|.||..:.:.:..|.
  Fly  1373 NVDFCADFIPVDYPDIRQSRPAFKKLIRACMPSHNTNEADGQSFAKMVEQSDWLQQISSLMQLSG 1437

  Fly   382 VVAQCLDQEGSPVLVHGAKGLDSTLIVTSLVQIILNPDCRTVRGLQALIEREWIQAGHPFASRHR 446
            .|...:|.:.|.|::....|.|.|..::|:.|:.|:|..|::.|.:.|:|:||:..||.||  ||
  Fly  1438 AVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDPYYRSLDGFRVLVEKEWLAFGHRFA--HR 1500

  Fly   447 YSCYTPNQTRNKTSGATFVLFLDCIYQLYTQFPCSFEFSTQLLILLFEHSHFSQYGTFLCDSERE 511
            .:....:...|.....||:.|||.::||..|||.:|||:...|..|..||...::.|||.|.|.|
  Fly  1501 SNLKPSHANTNIAFAPTFLQFLDVVHQLQRQFPMAFEFNDFYLRFLAYHSVSCRFRTFLFDCELE 1565

  Fly   512 RNE-------------------------------------LNVHTRTT---------SLWSYLNR 530
            |::                                     |::.::..         |::.|:.|
  Fly  1566 RSDSGIAAMEDKRGSLNAKHMFGAGGMATNGSDDECSVYPLDIRSQRAPAPLNRIGHSIFDYIER 1630

  Fly   531 P-DVLQTFLNPLYEPNANV-IWPSVAPISLELWSDLYLRWVIDQRSSVTVMSQIQELVTREKELR 593
            . :....|.|.||..:.:| :.|.....:|:||. .|....:.|.:...:     |:.|.:.|:.
  Fly  1631 QHNKTPIFYNFLYSGDKSVTLRPQNNVAALDLWC-YYTNEELAQGAPYDL-----EVTTVDDEID 1689

  Fly   594 TQALKLRKQAMELGQEVSNLMK 615
            ....|.::..:..|.:  |:.|
  Fly  1690 LSETKGKRMVITAGYD--NMEK 1709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5026NP_001163392.1 PH-GRAM_MTMR9 1..106 CDD:275398
Myotub-related 117..511 CDD:284109 100/388 (26%)
SbfNP_477401.2 uDENN 1..91 CDD:214824
DENN 142..325 CDD:280329
dDENN 384..452 CDD:129037
SBF2 585..807 CDD:289132
PH-GRAM_MTMR5_MTMR13 933..1047 CDD:275396
Myotub-related 1161..1565 CDD:284109 100/388 (26%)
C1 1791..1838 CDD:237996
PH_Sbf1_hMTMR5 1888..1993 CDD:269941
PH 1891..1992 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10807
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.