DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5026 and Mtmr10

DIOPT Version :9

Sequence 1:NP_001163392.1 Gene:CG5026 / 39026 FlyBaseID:FBgn0035945 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_001094316.1 Gene:Mtmr10 / 309255 RGDID:1305958 Length:771 Species:Rattus norvegicus


Alignment Length:562 Identity:135/562 - (24%)
Similarity:233/562 - (41%) Gaps:141/562 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KTPKLDGVLLHDPSNAGASGATVGTLCITGHHLLLSARQETSQ-ELW--LLHKN----------- 58
            |..||:.|||  |.....:.......||.         .:||| :||  |:..|           
  Rat    30 KIKKLEPVLL--PGEIVVNEVNFVRKCIA---------TDTSQYDLWGKLICSNFKISFITDDPM 83

  Fly    59 ------------------IDCVEKKPSLS----QNIVVGGIITLK---------CKDLRIISLEI 92
                              :.|:|:..:::    :..|:|....||         |||.||:....
  Rat    84 PLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKVLGPNQKLKFNPTELIIYCKDFRIVRFRF 148

  Fly    93 -KCGKEFF-NVAASLEALSAIQNTELLYPFFYRPMYSILEDGYTMFRPELEFAKLISGVGMGGAS 155
             :.|.|.. .|..::...|...:.:||:.|.|            :.:.....|..::||..||..
  Rat   149 DESGPESAKKVCLAIAHYSQPTDLQLLFAFEY------------VGKKYHNSANKVN
GVSSGGGG 201

  Fly   156 SPNVANITICMPSTSTSTLTVGAGIPH----PLQNGYA---IEALACGVGGVGGGALQSPQASCE 213
                              :..|||.|.    ||...|:   .|....|..|              
  Rat   202 ------------------VWSGAGSPSSQRTPLFETYSDWDRETKRTGASG-------------- 234

  Fly   214 WRITNVNRDFSVCATYGATLIVPKAITDEQIVLSAAFRDGGRFPVLSYRHENGATLMRSSQPLSI 278
            ||:.::|..:.:........:||.::.|:.:.:.:....|.|.|...:.|.||:.|:|.:  |..
  Rat   235 WRVCSINEGYMISTCLPEYFVVPSSLADQDLKIFSPSFVGRRMPCWCWSHSNGSALVRMA--LIK 297

  Fly   279 QGIKRCRADEAILNLVLGRSRKGFIVDTWGKGKSNTE-TDLHYSQWKKVNRSIGNVSSPASILDS 342
            ..:::.:.|:.|.|.:.               ||:.: :|::.|.   :::::.|:.   .|..:
  Rat   298 DVLQQRKIDQRICNAIT---------------KSHPQRSDVYKSD---LDKTLPNIQ---EIQAA 341

  Fly   343 FARLIEAC-NDLGCST-DKWLSRLENSGWLSLVLNSLNASCVVAQCLDQEGSPVLVHGAKGLDST 405
            |.:|.:.| |:....| :||||.||::.||..|...|..|..:...|:.:...|::...:|.|.:
  Rat   342 FVKLKQLCVNEPFEETEEKWLSSLESTRWLEYVRAFLKHSAELVYILESQRLSVVLQEEEGRDLS 406

  Fly   406 LIVTSLVQIILNPDCRTVRGLQALIEREWIQAGHPFASRHRYSCYTPNQTRNKTSGATFVLFLDC 470
            .:|.||||::::|..||:.|.|:|:::||:.||:||..|..:      ..|::.....|:||||.
  Rat   407 CLVASLVQVMMDPYFRTITGFQSLVQKEWVMAGYPFLDRCNH------LKRSEKESPLFLLFLDT 465

  Fly   471 IYQLYTQFPCSFEFSTQLLILLFEHSHFSQYGTFLCDSERER 512
            .:||..|:|.:||||...|.:|.:.:..|.:||||.:|..:|
  Rat   466 TWQLLEQYPAAFEFSETYLAVLCDSTRISLFGTFLFNSPHQR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5026NP_001163392.1 PH-GRAM_MTMR9 1..106 CDD:275398 30/144 (21%)
Myotub-related 117..511 CDD:284109 102/403 (25%)
Mtmr10NP_001094316.1 PH-GRAM_MTMR10 21..193 CDD:270154 36/185 (19%)
PTPc 222..503 CDD:304379 86/323 (27%)
3-PAP 574..701 CDD:289355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349510
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1089
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.