DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5026 and mtmr3

DIOPT Version :9

Sequence 1:NP_001163392.1 Gene:CG5026 / 39026 FlyBaseID:FBgn0035945 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_031747519.1 Gene:mtmr3 / 100494490 XenbaseID:XB-GENE-984945 Length:1224 Species:Xenopus tropicalis


Alignment Length:414 Identity:130/414 - (31%)
Similarity:194/414 - (46%) Gaps:72/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 WRITNVNRDFSVCATYGATLIVPKAITDEQIVLSAAFRDGGRFPVLSYRHE-NGATLMRSSQP-L 276
            |||:|:|..|.:|.:|...||:|..|||:::...|:||...|.|.:.|||: |||.:.|..|| :
 Frog   176 WRISNINEKFRLCPSYPQELIIPAWITDKELESVASFRSWKRIPAVVYRHQSNGAVIARCGQPEV 240

  Fly   277 S------------IQGI-KRCRADEA--------------------ILN---------------- 292
            |            :|.: |.|..|.:                    :|.                
 Frog   241 SWWGWRNADDEHLVQSVAKACATDSSRASPGKMTNGSCPRNQINGGVLTDVDFESSMSNIPPPES 305

  Fly   293 --------LVLGRSRKGFIVDTWGKGKSNTETDLHYSQWKKVNRSIGNVSSPASILDSFARLIEA 349
                    |:|........|....|| ...|...:|...:.|...:.|:.   ||..||..|...
 Frog   306 PSVQPQKLLILDARSYAAAVANRAKG-GGCECPEYYPNCEVVFMGMANIH---SIRKSFQSLRLL 366

  Fly   350 CNDLGCSTDKWLSRLENSGWLSLVLNSLNASCVVAQCLDQEGSPVLVHGAKGLDSTLIVTSLVQI 414
            |..:. ....|||.||.:.||..:...|.:|.:|...||::..|||||.:.|.|.|..:.:|.::
 Frog   367 CTQMP-DPANWLSALEGTKWLQHLSMLLKSSLLVVHTLDKDQRPVLVHCSDGWDRTPQIVALSKL 430

  Fly   415 ILNPDCRTVRGLQALIEREWIQAGHPFASRHRYSC-YTPNQTRNKTSGATFVLFLDCIYQLYTQF 478
            :|:|..||:.|.|.|:|.||:..||.||.|    | :..|..........|:.:|||::||..||
 Frog   431 LLDPYYRTIEGFQVLVETEWLDFGHKFADR----CGHGENSEDLNERCPVFLQWLDCVHQLQRQF 491

  Fly   479 PCSFEFSTQLLILLFEHSHFSQYGTFLCDSERERNELNVHTRTTSLWSYLNRPDVLQTFLNPLYE 543
            ||||||:...|:.|.:|::...:|||||::.:||:|.::..||.|:||.|...:  :.|.|.||.
 Frog   492 PCSFEFNEGFLVKLVQHTYSCLFGTFLCNNAKERSEKHIQERTCSVWSLLRAGN--RAFKNLLYS 554

  Fly   544 PNA-NVIWPSVAPISLELWSDLYL 566
            ..: .|::|.....:|.|||.:||
 Frog   555 SQSETVLYPVCHVRNLMLWSAVYL 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5026NP_001163392.1 PH-GRAM_MTMR9 1..106 CDD:275398
Myotub-related 117..511 CDD:284109 109/356 (31%)
mtmr3XP_031747519.1 PH-like 23..115 CDD:418428
PTP-MTMR3 169..486 CDD:350434 91/318 (29%)
FYVE_MTMR3 1137..1206 CDD:277271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.