DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5653 and Kdm1a

DIOPT Version :9

Sequence 1:NP_648269.1 Gene:CG5653 / 39024 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006539392.1 Gene:Kdm1a / 99982 MGIID:1196256 Length:877 Species:Mus musculus


Alignment Length:610 Identity:155/610 - (25%)
Similarity:229/610 - (37%) Gaps:197/610 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHG--- 66
            :.:.::||||:||||:||| |.||:...:|.:|||.||:|||:.|...|:.|.||||....|   
Mouse   297 KKTGKVIIIGSGVSGLAAA-RQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGG 360

  Fly    67 -------KQQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVV--------------PHELACRI 110
                   ||.|.....:|....|:|.......:|..:...|:|              .|:|...:
Mouse   361 NPMAVVSKQVNMELAKIKQKCPLYEANGQADTVKVPKEKDEMVEQEFNRLLEATSYLSHQLDFNV 425

  Fly   111 HDIAVKSMPSGPHPVVGSFGTHLTQ---TFWRKI---ESELPQVNRDVASEALNTFAKHESSIIG 169
            .:....|:......|:.....|:..   ..|:||   :.||        .|.||...        
Mouse   426 LNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEEL--------KELLNKMV-------- 474

  Fly   170 ADNLFEVSVREHIEYHECD-----GDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQ--- 226
              ||.|.....|.:|.|..     .|....:..|...|.|..|.|...:..|..|.||.::|   
Mouse   475 --NLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELE 537

  Fly   227 ----------------LDMKVIKIEL--ACPRKVI-LR--CQDGDY------------------- 251
                            ||.....:|.  |.|...: |:  .||.|:                   
Mouse   538 ANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVA 602

  Fly   252 --------------------------------------FEADHVICTVSLGVLQEQHEKL-FVPP 277
                                                  ::.|.|:||:.||||::|...: ||||
Mouse   603 LAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPP 667

  Fly   278 LPAAKVNAIRSLTLGTVNKLYLEYEK---QPLPD--GWVG--------FFCFWLEEDLIELRKTE 329
            ||..|.:|::.:..|.:||:.|.:::   .|..:  |.||        .|.||      .|.|..
Mouse   668 LPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFW------NLYKAP 726

  Fly   330 YFWVEGITGVHMITCQPRMLMAWVNGPHGRHMETLSDE-------KVLEGLYWLFRKFLTFEIPP 387
                              :|:|.|.|.....||.:||:       .:|:|:      |.:..:|.
Mouse   727 ------------------ILLALVAGEAAGIMENISDDVIVGRCLAILKGI------FGSSAVPQ 767

  Fly   388 PKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDL-ESPVLGEDGHLG-------LLFAGEASS 444
            ||..|.|.|.::|..|||:||   :|...:...:|| ..|:.......|       |.||||.:.
Mouse   768 PKETVVSRWRADPWARGSYSY---VAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTI 829

  Fly   445 RNHFSTVHGAVEAGYREADRLIDHY 469
            ||:.:|||||:.:|.|||.|:.|.:
Mouse   830 RNYPATVHGALLSGLREAGRIADQF 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 33/75 (44%)
Amino_oxidase 17..466 CDD:279874 149/593 (25%)
Kdm1aXP_006539392.1 PHA03378 <39..>99 CDD:223065
PLN02328 204..850 CDD:215187 153/604 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.