DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5653 and MAOB

DIOPT Version :9

Sequence 1:NP_648269.1 Gene:CG5653 / 39024 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_000889.3 Gene:MAOB / 4129 HGNCID:6834 Length:520 Species:Homo sapiens


Alignment Length:520 Identity:133/520 - (25%)
Similarity:218/520 - (41%) Gaps:128/520 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCRASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTV------YFGDNVIDLGA 61
            ||    .::::|.|:||:||| :||.::..||.:|||.||:|||..|:      |     :|||.
Human     4 KC----DVVVVGGGISGMAAA-KLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKY-----VDLGG 58

  Fly    62 QWCHGKQQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIHDIAVKSMP-SGPHPV 125
            .:. |..||.:..:.|::|:  ||   |.            .:|:...||.:..||.| .||.|.
Human    59 SYV-GPTQNRILRLAKELGL--ET---YK------------VNEVERLIHHVKGKSYPFRGPFPP 105

  Fly   126 VGSFGTHLT-QTFWRKIESELPQVNRDVASEA------------------LNTFAKHESS----- 166
            |.:..|:|. ..|||.::    .:.|::.|:|                  |:.....||:     
Human   106 VWNPITYLDHNNFWRTMD----DMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLAT 166

  Fly   167 -----IIGADNLFEVSVREHIEY-HECDGDKLLHWGTKG--YRRFLRLLMKVSADTPEELGLLEG 223
                 .:.|:. .|||....:.| .:|.|...:...|.|  .|:|:....:||   ...:.||..
Human   167 LFVNLCVTAET-HEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVS---ERIMDLLGD 227

  Fly   224 RIQLDMKVIKIELACPRKVILRCQDGDYFEADHVICTV--SLGVLQEQHEKL-FVPPLPAAKVNA 285
            |::|:..||.|: .....|::...:.:.:||.:||..:  :||:      |: |.||||..:...
Human   228 RVKLERPVIYID-QTRENVLVETLNHEMYEAKYVISAIPPTLGM------KIHFNPPLPMMRNQM 285

  Fly   286 IRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFWLEEDLIELRKTEYFWVEGITGVH------MITC 344
            |..:.||:|.|. :.|.|:|          ||        ||.:|.....|.|..      :...
Human   286 ITRVPLGSVIKC-IVYYKEP----------FW--------RKKDYCGTMIIDGEEAPVAYTLDDT 331

  Fly   345 QPR----MLMAWVNGPHGRHMETLSDEKVLEGLYWLFRKFL-TFEIPPPKRFVRSSWFSNPNFRG 404
            :|.    .:|.::.....|.:..|:.|:.|:.|..|:.|.| :.|...|..:...:|.......|
Human   332 KPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGG 396

  Fly   405 SWSY---RGVMADERNTGPWDLESPVLGEDGHLGLLFAGEASSRNHFSTVHGAVEAGYREADRLI 466
            .::.   .|::......    |..||   |   .:.|||..::.:....:.||||||.|.|..::
Human   397 CYTTYFPPGILTQYGRV----LRQPV---D---RIYFAGTETATHWSGYMEGAVEAGERAAREIL 451

  Fly   467  466
            Human   452  451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 27/71 (38%)
Amino_oxidase 17..466 CDD:279874 129/504 (26%)
MAOBNP_000889.3 Amino_oxidase 14..451 CDD:396255 129/504 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.