DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5653 and il4i1

DIOPT Version :9

Sequence 1:NP_648269.1 Gene:CG5653 / 39024 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_009289997.1 Gene:il4i1 / 337166 ZFINID:ZDB-GENE-030131-9110 Length:504 Species:Danio rerio


Alignment Length:554 Identity:115/554 - (20%)
Similarity:196/554 - (35%) Gaps:191/554 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDN--VIDLGAQWC--- 64
            :....::|:|||.:|:.|| :.|::....|.|:||.|||||||.|...|..  ..:|||...   
Zfish    48 KTPKHVLIVGAGAAGLTAA-KFLEDAGHKVTIIEASDRIGGRIQTFRNGREGWYAELGAMRIPSF 111

  Fly    65 H--------------GK----QQNCVYDMVKDMGILHETGDYYSPIKRVRSNKEVVPHELACRIH 111
            |              ||    ..|..|.:   .|..|:|   |:    |:.|.:|:         
Zfish   112 HRILLAVAQKLSLKLGKFVQDDPNTYYYI---NGERHKT---YT----VKQNPDVL--------- 157

  Fly   112 DIAVKSMPSGPHPVV----GSFGTHLTQTFWRKIESELPQVNRDVASEALNTFAKH--ESSIIGA 170
                      .:||.    |...:.|......|::.:|.::.   ..:.|||:..:  :..::..
Zfish   158 ----------NYPVYNQERGKNASELFNIALSKLQDDLHKMG---CEKMLNTYDSYSVKEYLVNV 209

  Fly   171 DNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMKVSADTPEE------LG---------- 219
            .||...::|       ..||.|..  ...|...|..::.:.:|..::      ||          
Zfish   210 ANLSRGALR-------MIGDVLNE--NSFYYTALTEMLYIQSDISDDQQYFEFLGGFETFPNAFY 265

  Fly   220 -LLEGRIQLDMKVIKIELACPRKVILRCQDG------DY--------FEADHVICTVSLGVLQEQ 269
             :|...|.::.||         :.|.:.|||      |:        ...|:|:.|      ...
Zfish   266 SVLNATILMNSKV---------QAISQTQDGVTVSYQDWRNLGEMTNITGDYVLVT------STA 315

  Fly   270 HEKLFV---PPLPAAKVNAIRSLTLGTVNKLYLEYEKQPLPDGWVGFFCFWLEEDLIELRKTEYF 331
            ...||.   |||.|.|:.|:||:...:..|:.|.:.::           ||...|          
Zfish   316 KATLFFDFNPPLSADKMEALRSVHYSSSTKVVLSFSQK-----------FWKNND---------- 359

  Fly   332 WVEGITGVHMITCQP-----------------RMLMAWVNGPHGRHMETLSDEK----VLEGLYW 375
               ||.|...||..|                 .:|.::........::||.:|:    ||..|..
Zfish   360 ---GIKGGKSITDLPSRFIYYPSHEFPGITGGAILASYTTSDDATLLQTLDEEELKAVVLNDLVK 421

  Fly   376 L----FRKFLTFEIPPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPW---DLESPVLGEDGH 433
            :    .|:..|       ......|..:|...|:::.         ..|:   |..:.::..:|.
Zfish   422 IHGEHIRQLCT-------GGAVKKWGMDPYSHGAFAI---------FTPFQMRDYSASLVQNEGR 470

  Fly   434 LGLLFAGEASSRNHFSTVHGAVEAGYREADRLID 467
              :.||||.::|.| ..:..|:::..|.||::.|
Zfish   471 --IYFAGEHTARPH-GWIETAMKSALRAADKIND 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 29/88 (33%)
Amino_oxidase 17..466 CDD:279874 110/539 (20%)
il4i1XP_009289997.1 YobN 69..501 CDD:224152 107/530 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.