DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5653 and KDM1A

DIOPT Version :9

Sequence 1:NP_648269.1 Gene:CG5653 / 39024 FlyBaseID:FBgn0035943 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006710537.1 Gene:KDM1A / 23028 HGNCID:29079 Length:878 Species:Homo sapiens


Alignment Length:612 Identity:154/612 - (25%)
Similarity:227/612 - (37%) Gaps:199/612 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RASSRIIIIGAGVSGIAAATRLLQNNFQNVQILEAEDRIGGRINTVYFGDNVIDLGAQWCHG--- 66
            :.:.::||||:||||:||| |.||:...:|.:|||.||:|||:.|...|:.|.||||....|   
Human   296 KKTGKVIIIGSGVSGLAAA-RQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGG 359

  Fly    67 -------KQQNCVYDMVKDMGILHETGDYYSP----------IKRVRSNKEVVPHELACRIHDIA 114
                   ||.|.....:|....|:|......|          ..|:......:.|:|...:.:..
Human   360 NPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNK 424

  Fly   115 VKSMPSGPHPVVGSFGTHLTQ---TFWRKI---ESELPQVNRDVASEALNTFAKHESSIIGADNL 173
            ..|:......|:.....|:..   ..|:||   :.||        .|.||...          ||
Human   425 PVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEEL--------KELLNKMV----------NL 471

  Fly   174 FEVSVREHIEYHECD-----GDKLLHWGTKGYRRFLRLLMKVSADTPEELGLLEGRIQ------- 226
            .|.....|.:|.|..     .|....:..|...|.|..|.|...:..|..|.||.::|       
Human   472 KEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPP 536

  Fly   227 ------------------LDMKVIKIEL--ACPRKVI-LR--CQDGDY----------------- 251
                              ||.....:|.  |.|...: |:  .||.|:                 
Human   537 SPLFFCSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVP 601

  Fly   252 ----------------------------------------FEADHVICTVSLGVLQEQHEKL-FV 275
                                                    ::.|.|:||:.||||::|...: ||
Human   602 VALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFV 666

  Fly   276 PPLPAAKVNAIRSLTLGTVNKLYLEYEK---QPLPD--GWVG--------FFCFWLEEDLIELRK 327
            ||||..|.:|::.:..|.:||:.|.:::   .|..:  |.||        .|.||      .|.|
Human   667 PPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFW------NLYK 725

  Fly   328 TEYFWVEGITGVHMITCQPRMLMAWVNGPHGRHMETLSDE-------KVLEGLYWLFRKFLTFEI 385
            ..                  :|:|.|.|.....||.:||:       .:|:|:      |.:..:
Human   726 AP------------------ILLALVAGEAAGIMENISDDVIVGRCLAILKGI------FGSSAV 766

  Fly   386 PPPKRFVRSSWFSNPNFRGSWSYRGVMADERNTGPWDL-ESPVLGEDGHLG-------LLFAGEA 442
            |.||..|.|.|.::|..|||:||   :|...:...:|| ..|:.......|       |.||||.
Human   767 PQPKETVVSRWRADPWARGSYSY---VAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEH 828

  Fly   443 SSRNHFSTVHGAVEAGYREADRLIDHY 469
            :.||:.:|||||:.:|.|||.|:.|.:
Human   829 TIRNYPATVHGALLSGLREAGRIADQF 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5653NP_648269.1 NAD_binding_8 12..78 CDD:290186 33/75 (44%)
Amino_oxidase 17..466 CDD:279874 148/595 (25%)
KDM1AXP_006710537.1 SWIRM 197..284 CDD:282311
NAD_binding_8 303..361 CDD:290186 30/58 (52%)
Amino_oxidase 308..851 CDD:279874 147/594 (25%)
SurA_N_3 <395..491 CDD:304439 20/113 (18%)
NAT_SF <441..>549 CDD:302625 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.