DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ValRS-m and AT1G27160

DIOPT Version :9

Sequence 1:NP_001286988.1 Gene:ValRS-m / 39023 FlyBaseID:FBgn0035942 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_174036.1 Gene:AT1G27160 / 839605 AraportID:AT1G27160 Length:200 Species:Arabidopsis thaliana


Alignment Length:188 Identity:46/188 - (24%)
Similarity:83/188 - (44%) Gaps:37/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 FYQY-LCDTYLETTKPAIGNRSADAY--IHV-GTLTACLSWGLQAMAPYAPFVASELLQHVPLN- 816
            ::|| .||.::|..||..   |||..  ||. ..|..||..||:.:.|:.|::..||.|.:|.: 
plant    14 WWQYQFCDVFIEAIKPYF---SADTQRRIHAQDALWVCLETGLRLLHPFMPYITEELWQRLPSSQ 75

  Fly   817 -----IELKLSDY-------KDEKLEEEVNEIVNICHNVRQVKSRNEISKRHHPQLSLFA--QNT 867
                 ..:.:.||       .:||:|.|::.::.....:|.:::...:.::.:.:...||  .|.
plant    76 DSERKASIMICDYPSSIEMWTNEKVETEMDMVLATVKTLRALRAAESLKRQRNEKFHAFALSGNA 140

  Fly   868 DSEGVLRRHLPQIKVLSRCEDVELELFDESSK-----------ISKQLSYFSTAGALC 914
            .:.|:::.|..:|:.|:.....|:.|..|...           ||..:.||    .||
plant   141 LTLGIVKPHELEIRTLANLSSFEVMLRGEDKAFVVCWEEIEIWISYNVLYF----ILC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ValRS-mNP_001286988.1 PTZ00419 23..989 CDD:240411 46/188 (24%)
ValRS_core 73..675 CDD:185677
tRNA-synt_1_2 268..391 CDD:290334
Anticodon_Ia_Val 675..812 CDD:153416 21/58 (36%)
AT1G27160NP_174036.1 Anticodon_1 5..125 CDD:285464 30/113 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001015
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.