DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13313 and CG14280

DIOPT Version :9

Sequence 1:NP_648267.1 Gene:CG13313 / 39022 FlyBaseID:FBgn0035941 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001287405.1 Gene:CG14280 / 42312 FlyBaseID:FBgn0038695 Length:555 Species:Drosophila melanogaster


Alignment Length:404 Identity:104/404 - (25%)
Similarity:172/404 - (42%) Gaps:55/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SKANESLILANDT----LLAEDGNSSLVHSGSRHPR-----WFPFYTIGRFSNDIC---VGN-NL 91
            |....|::..:.|    |......::|:......||     :...:.:.:|.|..|   :|: ..
  Fly   175 SSTKSSIMQPHQTLKNILFGSPIKANLILKKPNAPRSKGKGFLSLFEVIKFPNTKCSVSMGDIRS 239

  Fly    92 LLGTCVINGECTDNSGVAAGSCSSITAQAICCIYQRTCGASTSYNNTYFYNSNYPAPYGGGGRCS 156
            :.|.|....||....|:...||:.  ...:||::...||..||....||.:.|||........|.
  Fly   240 MEGVCYHEFECKSLGGIPTESCAE--GVGVCCVFVNGCGDVTSQQILYFESPNYPNAVREMMICV 302

  Fly   157 IVVTPPDSSICQLRVDFLSLSLAPPSGDGSCSTDALTITGGAS--QVPSICGENAGQHVYV---D 216
            :::. ....:.|||:||....|:.|| :|.|..|...::|..:  |:|.:||.|.|||:|:   |
  Fly   303 LIIN-VKKGVQQLRLDFQMFELSRPS-NGDCVDDQFIVSGHNTNFQIPILCGINTGQHIYIHVGD 365

  Fly   217 FN-GVSPITISVATSGSYTFNRNWQFQIRMLGCTSATLAPAGCLQYYMPSSGTLASFNYNSAAAS 280
            .| |...:::.:..||.   .|::..::..:   ...|||..||||:..:.|.:.||||::..:.
  Fly   366 SNEGKVYLSVFMKVSGG---GRSFNIKVTQV---DDNLAPNNCLQYFHDAEGVIKSFNYDTDGSI 424

  Fly   281 ALNSIGVQGTRQLANTKYGICIRKAAGMCSITYS--QVGSDTYSFTLTNDVGAVDPTLLATSSVQ 343
            ..|    :......|..|.||:.:...:||:.|:  |:|.|...|.:.|...| :..|::.....
  Fly   425 VDN----REATYFNNLNYAICLARLKNVCSVAYNTEQLGGDQPDFQIINKDEA-ENDLISDGQAG 484

  Fly   344 SQ--ECTTDYIIIPSPTQGGVAMPSDRF--------CGLGLVSTTTSAKPFVVYTVTDGNEDMDI 398
            :.  .|..|:|.|.|     |.:..:||        ..:......|:|.|.::...||.    :.
  Fly   485 AGIFNCPDDFIAINS-----VPLCGERFNDGRESDDYTIHATVRDTAAGPIILPFRTDS----EY 540

  Fly   399 SNRGFYLSYSQNAC 412
            ..|||.|.|.|..|
  Fly   541 VGRGFRLLYKQELC 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13313NP_648267.1 CUB 129..>214 CDD:294042 30/86 (35%)
CG14280NP_001287405.1 MPDZ_u10 132..>180 CDD:293272 1/4 (25%)
CUB 275..391 CDD:238001 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29Q0H
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.