DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13313 and CG13310

DIOPT Version :9

Sequence 1:NP_648267.1 Gene:CG13313 / 39022 FlyBaseID:FBgn0035941 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_648257.1 Gene:CG13310 / 39007 FlyBaseID:FBgn0035928 Length:401 Species:Drosophila melanogaster


Alignment Length:379 Identity:134/379 - (35%)
Similarity:182/379 - (48%) Gaps:60/379 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PRW-----FPFYTIGRFSNDICVGNNLLLGTCVINGECTDNSGVAAGSCSSITAQAICCIYQRTC 129
            |||     .|.:.:.......|...:...|.|:.:.:|...:|:.||.|..  ...:|||:.:||
  Fly    43 PRWRESKFLPIFALVPIGPGSCSAPSGEQGNCIPSKDCVLRNGIPAGPCGG--GYGVCCIFLQTC 105

  Fly   130 GASTSYNNTYFYNSNYPAPYGGGGRCSIVVTPPDSSICQLRVDFLSLSLAPP-SGDGSCSTDALT 193
            |.....|:|||.|.|:|..|.|.|.|.:.|......|||||:|....|:||| :.:..|:.|.|.
  Fly   106 GGIIRENSTYFVNPNHPDVYDGTGSCQVTVQKLHPDICQLRLDLDMFSIAPPEAANHLCNQDQLL 170

  Fly   194 ITGGASQVPSICGENAGQHVYVD--FNGVSPITISVATSGSYTFNRNWQFQIRMLGCTSATLAPA 256
            |:|| |..|:|||.:.|.|:|:|  ....:||.:||.||||  |.|.|:.::..:.|.|.:.|..
  Fly   171 ISGG-SPTPTICGSSTGDHMYIDAGLGQSNPIVLSVITSGS--FPRLWRIRVTQIHCGSISRADQ 232

  Fly   257 GCLQYYMPSSGTLASFNYNSAAASALNSIGVQGTRQLANTKYGICIRKAAGMCSITYSQV----G 317
            ||||||...||.:.|||||:.           |.|||:|..|.||||.....|.|.|:..    .
  Fly   233 GCLQYYTAISGRVRSFNYNTV-----------GGRQLSNQDYSICIRNERNFCGIQYNACPDLEN 286

  Fly   318 SDTYSFTLT----NDV-------GAVDPTLLATSSVQSQECTTDYIIIPSPTQGGVAMP----SD 367
            :.:.|||||    |.|       |.:.|.|        ..||:|:::|..........|    .|
  Fly   287 NRSRSFTLTGNSNNPVATMVGGGGGMPPNL--------NGCTSDWLLIGCIRSADRIPPLPGCED 343

  Fly   368 RFCG------LGLVSTT--TSAKPFVVYTVTDGNE-DMDISNRGFYLSYSQNAC 412
            |.||      .|:::.|  :|.:||.:|..|||.| ..||.||||.|.|.|..|
  Fly   344 RVCGGTFSAEAGMLAKTVQSSVRPFRLYFHTDGVEAPNDIDNRGFCLDYVQQPC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13313NP_648267.1 CUB 129..>214 CDD:294042 37/85 (44%)
CG13310NP_648257.1 CUB 105..191 CDD:294042 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100223at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.