DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and UTR2

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_010874.3 Gene:UTR2 / 856671 SGDID:S000000766 Length:467 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:39/191 - (20%)
Similarity:63/191 - (32%) Gaps:56/191 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 GEKCTGQANTHDCVRNGRTLNDGLPPMVTAQFSS---KDFSFKYGRVEV-RAKMPRAQWVTPQIW 305
            ||..|||...::|.......:|...|:...:.||   ||:|.|.|.... ...:..|.|:.    
Yeast    44 GECGTGQYCLNNCDVRYSFSHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGNVSEADWLY---- 104

  Fly   306 LQPRRPIYGVDDYRSGQLRIAYTRPNGGNLDLYGAAVLFADEPLRSVKN----------CLKPGT 360
               ...:...||..|  |.:|..:.:||.:.....||.:.....| :|.          .|..|.
Yeast   105 ---TGDVLDYDDEES--LILAMPKNSGGTVLSSTRAVWYGKVSAR-IKTSHLAGVVTGFILYSGA 163

  Fly   361 GN--------------------------------NSEDWSDSFHNYTLEWTPRELRWLVDG 389
            |:                                ::.|..:::|.|.|:|....:.|.:||
Yeast   164 GDELDYEFVGADLETAQTNFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 39/191 (20%)
UTR2NP_010874.3 ChtBD1_GH16 25..71 CDD:211314 8/26 (31%)
GH16_fungal_CRH1_transglycosylase 91..302 CDD:185692 24/144 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345585
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.