DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and CRH1

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_011705.1 Gene:CRH1 / 853102 SGDID:S000003421 Length:507 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:52/256 - (20%)
Similarity:80/256 - (31%) Gaps:80/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 VLSTNTMKKQFKKGSGESLDLGEKCTGQANTHDC---VRNGRTLNDGLPPMVTAQFSS------- 278
            |||.:::...|  .:.||....:..|..::|..|   ...|.|.:..|....:..|||       
Yeast     9 VLSASSLLSTF--AAAESTATADSTTAASSTASCNPLKTTGCTPDTALATSFSEDFSSSSKWFTD 71

  Fly   279 ----------------------------KDFSFKYGRVEVRAKMPRAQWVTPQIWLQPRRPIYGV 315
                                        .:|...||::||..|......:....:||.       
Yeast    72 LKHAGEIKYGSDGLSMTLAKRYDNPSLKSNFYIMYGKLEVILKAANGTGIVSSFYLQS------- 129

  Fly   316 DDYRSGQLRIAYTRPNGGNLDLYGAAVLFADEPLRSVKNCLKPGTGNNSEDWSDSFHNYTLEWTP 380
            ||.  .::.|.:.  .|.|...........|      ......|..:..:..:|.||||||:|..
Yeast   130 DDL--DEIDIEWV--GGDNTQFQSNFFSKGD------TTTYDRGEFHGVDTPTDKFHNYTLDWAM 184

  Fly   381 RELRWLVDGKEWCVQGSAKGSFSETTAAGKSLPQAQKLEEGTGLAPFDQEFYLTFGLSVGG 441
            .:..|.:||:...|       .|.|::.|  .||:              ..||..|:..||
Yeast   185 DKTTWYLDGESVRV-------LSNTSSEG--YPQS--------------PMYLMMGIWAGG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 52/256 (20%)
CRH1NP_011705.1 GH16_fungal_CRH1_transglycosylase 74..258 CDD:185692 37/189 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.