DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and CRR1

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_013314.1 Gene:CRR1 / 850910 SGDID:S000004203 Length:422 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:59/306 - (19%)
Similarity:101/306 - (33%) Gaps:119/306 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 GSFVVNGYSGNNASPHPPVVP------VSTTPWTPPADPDIDIRLGCTTPKTEVNGAPTRCAGQL 175
            |..|.:.:...:.:|.|.:|.      |||     |..|...:......|..|.|| |.:...::
Yeast    59 GCNVRSSFDEESCAPIP
ALVASQKLEFVST-----PKVPKFIVNYQPKPPIREGNG-PNKANTKV 117

  Fly   176 VFVD-EFNAAKL--------DPNKWKAERRFSGQPDYEFNVYVDDAPETLCLANGHVVLSTNTMK 231
            ..|: |.|:.::        .|:..:||:...   |::|   ......::..::|::||:     
Yeast   118 GVVEGELNSKRIIHYAKFLVTPDSKEAEKMLE---DFDF---THSGYTSIEASSGNIVLA----- 171

  Fly   232 KQFKKGSGESLDLGEKCTGQANTHDCVRNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPR 296
                                                :|...|....:...||.||:..||.|..|
Yeast   172 ------------------------------------MPKKTTGSLITSTRSFLYGKASVRMKTAR 200

  Fly   297 AQWVTPQI-------------WLQPRRPIYGVDDYRSGQLRIA----YTRPNGGNLDLYGAAVLF 344
            ::.|....             ||             .|.|..|    |::   |:|| |.....|
Yeast   201 SRGVVTAFDLTSAIGDEIDFEWL-------------GGDLMTAQSNYYSQ---GHLD-YTRMQRF 248

  Fly   345 ADEPLRSVKNCLKPGTGNNSEDWSDSFHNYTLEWTPRELRWLVDGK 390
               |:             .::.|: ::|.|.::|.|..:.|.||||
Yeast   249 ---PV-------------GADTWA-TYHTYEIDWDPDRIIWYVDGK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510 2/14 (14%)
GH16_beta_GRP 175..489 CDD:185688 44/242 (18%)
CRR1NP_013314.1 ChtBD1_GH16 29..75 CDD:211314 3/15 (20%)
GH16_fungal_CRH1_transglycosylase 143..354 CDD:185692 40/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345589
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.