DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and XTH6

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_569019.1 Gene:XTH6 / 836702 AraportID:AT5G65730 Length:292 Species:Arabidopsis thaliana


Alignment Length:332 Identity:71/332 - (21%)
Similarity:102/332 - (30%) Gaps:113/332 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 VYVDDAPETLCLANG--------HVVLSTNTMKKQFKKGSGESLDLGEKCTGQANTHDCVRNGRT 263
            :|....|.||||...        .|.....|..:.||....||                  :.|.
plant     4 IYSPSFPGTLCLCIFTLLTLMFIRVSARPATFVEDFKAAWSES------------------HIRQ 50

  Fly   264 LNDG------LPPMVTAQFSSKDFSFKYGRVEVRAKM---PRAQWVTPQIWLQPRRPIYGVDDY- 318
            :.||      |.......|:||. .:.:|||.::.|:   ..|..||..........:....|: 
plant    51 MEDGKAIQLVLDQSTGCGFASKR-KYLFGRVSMKIKLIPGDSAGTVTAFYMNSDTATVRDELDFE 114

  Fly   319 ----RSGQLRIAYTRPNGGNLDLYGAAVLFADEPLRSVKNCLKPGTGNNSED---WSD---SFHN 373
                ||||                         |.....|....|.|:..:.   |.|   .:|.
plant   115 FLGNRSGQ-------------------------PYSVQTNIFAHGKGDREQRVNLWFDPSMDYHT 154

  Fly   374 YTLEWTPRELRWLVDG---KEWCVQGSAKGSFSETTAAGKSLP--------QAQKLEEGTGL--- 424
            ||:.|:.:.:.:.||.   :|:      |.:.::..|...|.|        :|.......||   
plant   155 YTILWSHKHIVFYVDDVPIREY------KNNEAKNIAYPTSQPMGVYSTLWEADDWATRGGLEKI 213

  Fly   425 ----APFDQEFYLTF---GLSVGG-----FNEYQHEIKPWNERAPQAQKAFWKEVKKIRDHWLDE 477
                ||| ..:|..|   |..|.|     .|.:..    |...|.|:..|    |:..|..|:..
plant   214 DWSKAPF-YAYYKDFDIEGCPVPGPTFCPSNPHNW----WEGYAYQSLNA----VEARRYRWVRV 269

  Fly   478 GHMKIDY 484
            .||..||
plant   270 NHMVYDY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 71/332 (21%)
XTH6NP_569019.1 PLN03161 19..290 CDD:178706 65/317 (21%)
GH16_XET 33..290 CDD:185685 64/303 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.