DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and XTH12

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_200561.1 Gene:XTH12 / 835857 AraportID:AT5G57530 Length:285 Species:Arabidopsis thaliana


Alignment Length:265 Identity:53/265 - (20%)
Similarity:92/265 - (34%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GQANTHDCVRNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPRAQWVTPQIWLQPRRPIYG 314
            |:||..:   :|:.|...|.....:.|.||. .:.:|:::::.|:                    
plant    38 GRANIFE---SGQLLTCTLDKTSGSGFQSKK-EYLFGKIDMKIKL-------------------- 78

  Fly   315 VDDYRSGQLRIAYTRPNGGNLDLYGAAVL--FADEPLRSVKNCLKPGTGNNSED---WSD---SF 371
            |....:|.:...|....|...|......|  ...:|.....|....|.||....   |.|   .|
plant    79 VPGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVIHTNVFTGGKGNREMQFYLWFDPTADF 143

  Fly   372 HNYTLEWTPRELRWLVDGKEWCVQGSAKGSFSETTAAGKSLPQAQKLEEGTGLAPFDQEFYLT-- 434
            |.||:.|.|..:.:||||....|       |....|.|.:.|::|.::..:.|  ::.:.:.|  
plant   144 HTYTVLWNPLNIIFLVDGIPIRV-------FKNNEANGVAYPKSQPMKIYSSL--WEADDWATQG 199

  Fly   435 -----------FGLSVGGFNEYQ--HEIKPWNERAPQAQKAFW-------KEVKKIRDHWLDEGH 479
                       |..|...||:..  .....||.....|....|       .::.:::  |:.:.:
plant   200 GKVKTDWTNAPFSASYRSFNDVDCCSRTSIWNWVTCNANSNSWMWTTLNSNQLGQLK--WVQKDY 262

  Fly   480 MKIDY 484
            |..:|
plant   263 MIYNY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 53/265 (20%)
XTH12NP_200561.1 GH16_XET 23..282 CDD:185685 53/265 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.