Sequence 1: | NP_523986.2 | Gene: | GNBP3 / 39020 | FlyBaseID: | FBgn0040321 | Length: | 490 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_194757.1 | Gene: | XTH18 / 829151 | AraportID: | AT4G30280 | Length: | 282 | Species: | Arabidopsis thaliana |
Alignment Length: | 207 | Identity: | 44/207 - (21%) |
---|---|---|---|
Similarity: | 71/207 - (34%) | Gaps: | 64/207 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 GQANTHDCVRNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPRAQWVTPQIWLQPRRPIYG 314
Fly 315 VDDYRSGQLRIAYTRPNG-----------GNLDLYGAAVLFADEPLRSVKNCLKPGTGNNSED-- 366
Fly 367 -WSD---SFHNYTLEWTPRELRWLVDG---KEWCVQGSAKGSFSETTAAGKSLPQAQKLEEGTGL 424
Fly 425 APFDQEFYLTFG 436 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GNBP3 | NP_523986.2 | CBM39 | 27..132 | CDD:292510 | |
GH16_beta_GRP | 175..489 | CDD:185688 | 44/207 (21%) | ||
XTH18 | NP_194757.1 | LamG | 25..281 | CDD:419873 | 44/207 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1209387at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |