DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and XTH14

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_194312.1 Gene:XTH14 / 828687 AraportID:AT4G25820 Length:287 Species:Arabidopsis thaliana


Alignment Length:284 Identity:57/284 - (20%)
Similarity:90/284 - (31%) Gaps:101/284 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 TLCLANGHVVLSTNTMKKQFKKGSG---ESLDL--GEKCTGQANTHDCVRNGRTLNDGLPPMVTA 274
            :|.||.|..|::.:         :|   ||.|:  |   .|:||..:   ||:.|...|..:..:
plant    13 SLLLAIGFFVVAAS---------AGNFYESFDITWG---NGRANIFE---NGQLLTCTLDKVSGS 62

  Fly   275 QFSSKDFSFKYGRVEVRAKMPRAQWVTPQIWLQPRRPIYGVDDYRSGQLRIAYTRPNGGNLDLYG 339
            .|.||. .:.:|:::::.|:                    |....:|.:...|....|...|...
plant    63 GFQSKK-EYLFGKIDMKLKL--------------------VAGNSAGTVTAYYLSSKGTAWDEID 106

  Fly   340 AAVL--FADEPLRSVKNCLKPGTGNNSED---WSD---SFHNYTLEWTPRELRWLVDGKEWCVQG 396
            ...|  ....|.....|....|.|:....   |.|   .||.||:.|.|..:.:||||....|  
plant   107 FEFLGNRTGHPYTIHTNVFTGGKGDREMQFRLWFDPTADFHTYTVHWNPVNIIFLVDGIPIRV-- 169

  Fly   397 SAKGSFSETTAAGKSLPQAQKLEEGTGLAPFDQEFYLTFGLSVGGFNEYQHEIKPWNERAPQAQK 461
                 |......|.:.|:.|.:                                       :...
plant   170 -----FKNNEKNGVAYPKNQPM---------------------------------------RIYS 190

  Fly   462 AFWKEVKKIRDHWLDE-GHMKIDY 484
            :.|:     .|.|..| |.:|||:
plant   191 SLWE-----ADDWATEGGRVKIDW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 57/284 (20%)
XTH14NP_194312.1 GH16_XET 25..285 CDD:185685 52/272 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.