DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and XTH2

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_193045.1 Gene:XTH2 / 826923 AraportID:AT4G13090 Length:292 Species:Arabidopsis thaliana


Alignment Length:279 Identity:53/279 - (18%)
Similarity:82/279 - (29%) Gaps:110/279 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LNDGLPPMVTAQFSS-KDFSFK--YGR--VEVRAKMPRAQWVTPQIWLQPRRPIYGVDDYRSGQL 323
            ||.|....::..:|| ..|..|  ||.  .::|.|:|            ||.        .:|.:
plant    48 LNQGKEVQLSMDYSSGSGFESKSHYGSGFFQMRIKLP------------PRD--------SAGVV 92

  Fly   324 RIAYTRPNGGNLDLYGAAVL--FADEPLRSVKNCLKPGTGNNSE---DWSD---SFHNYTLEWTP 380
            ...|....|...|......|  ...:|:....|....|.|...:   .|.|   |||.|.:.|.|
plant    93 TAFYLTSKGDTHDEVDFEFLGNRQGKPIAIQTNVFSNGQGGREQKFVPWFDPTTSFHTYGILWNP 157

  Fly   381 RELRWLVD------------------------------GKEWCVQGSAKGSFSETTAAGKSLPQA 415
            .::.:.||                              |:.|            .|:.||     
plant   158 YQIVFYVDKVPIRVFKNIKKSGVNYPSKPMQLVASLWNGENW------------ATSGGK----- 205

  Fly   416 QKLEEGTGLAPFDQEFYLTFGLSVGGFNEYQHEIKP--------------WNERA-PQAQKAFWK 465
            :|:  ....|||..::.        ||:::...:..              ||.|. .|......|
plant   206 EKI--NWAYAPFKAQYQ--------GFSDHGCHVNGQSNNANVCGSTRYWWNTRTYSQLSANEQK 260

  Fly   466 EVKKIRDHWLDEGHMKIDY 484
            .::.:|     ..:|..||
plant   261 VMENVR-----AKYMTYDY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 53/279 (19%)
XTH2NP_193045.1 GH16_XET 27..288 CDD:185685 53/279 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.