DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and XTH1

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_193044.3 Gene:XTH1 / 826922 AraportID:AT4G13080 Length:295 Species:Arabidopsis thaliana


Alignment Length:276 Identity:57/276 - (20%)
Similarity:85/276 - (30%) Gaps:87/276 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GQANTHDCVRNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPRAQWVTPQIWLQPRRPIYG 314
            ||.|... :..|:.:...|.....:.|.||: .::.|..::|.|:|            |:.    
plant    48 GQNNVLK-LNQGKEVQLSLDHSSGSGFESKN-HYESGFFQIRIKVP------------PKD---- 94

  Fly   315 VDDYRSGQLRIAYTRPNGGNLDLYGAAVLFADEPLRSVK-NCLKPGTGNNSE------DWSDSFH 372
                .||.:...|....|...|......|...|...:|: |....|.||..:      |.|..||
plant    95 ----TSGVVTAFYLTSKGNTHDEVDFEFLGNKEGKLAVQTNVFTNGKGNREQKLALWFDPSKDFH 155

  Fly   373 NYTLEWTPRELRWLVDGKEWCVQGSAKGSFSETTAAGKSLP------------------QAQKLE 419
            .|.:.|.|.::...||.....|       |..||:.|.:.|                  ...|.:
plant   156 TYAILWNPYQIVLYVDNIPVRV-------FKNTTSQGMNYPSKPMQVVVSLWNGENWATDGGKSK 213

  Fly   420 EGTGLAPFDQEFYLTFGLSVGGFNE----------------YQHEIKPWNERAPQAQKAFWKEVK 468
            ....||||...|.        |||.                |......:::.:...|||:....:
plant   214 INWSLAPFKANFQ--------GFNNSGCFTNAEKNACGSSAYWWNTGSYSKLSDSEQKAYTNVRQ 270

  Fly   469 KIRDHWLDEGHMKIDY 484
            |         :|..||
plant   271 K---------YMNYDY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 57/276 (21%)
XTH1NP_193044.3 GH16_XET 34..291 CDD:185685 57/276 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.