DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and XTH21

DIOPT Version :10

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_179470.1 Gene:XTH21 / 816395 AraportID:AT2G18800 Length:305 Species:Arabidopsis thaliana


Alignment Length:174 Identity:39/174 - (22%)
Similarity:66/174 - (37%) Gaps:55/174 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 KGSGESLDL--GEKCTGQANTHDCVRNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPRAQ 298
            |...:.:|:  |:   |:.|   .:.||..||.||.....:.|.|| ..:.||:|:::.|:    
plant    26 KDFNQDIDITWGD---GRGN---ILNNGTLLNLGLDQSSGSGFQSK-AEYLYGKVDMQIKL---- 79

  Fly   299 WVTPQIWLQPRRPIYGVDDYRSGQLRIAYTRPNG-----------GNLDLYGAAVLFADEPLRSV 352
                            |....:|.:...|.:..|           ||:         :.:|....
plant    80 ----------------VPGNSAGTVTTFYLKSQGLTWDEIDFEFLGNV---------SGDPYIVH 119

  Fly   353 KNCLKPGTGNNSED---WSD---SFHNYTLEWTPRELRWLVDGK 390
            .|....|.|:..:.   |.|   :||||::.|.|..:.:.:|||
plant   120 TNVYTQGKGDREQQFYLWFDPTAAFHNYSILWNPSHIVFYIDGK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:464924
GH16_beta_GRP 175..489 CDD:185688 39/174 (22%)
XTH21NP_179470.1 GH16_XET 27..296 CDD:185685 38/173 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.