Sequence 1: | NP_523986.2 | Gene: | GNBP3 / 39020 | FlyBaseID: | FBgn0040321 | Length: | 490 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_178294.1 | Gene: | EXGT-A3 / 814716 | AraportID: | AT2G01850 | Length: | 333 | Species: | Arabidopsis thaliana |
Alignment Length: | 231 | Identity: | 39/231 - (16%) |
---|---|---|---|
Similarity: | 70/231 - (30%) | Gaps: | 101/231 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 RNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPRAQWVTPQIWLQPRRPIYGVDDYRSGQL 323
Fly 324 RIAYTRPNG---------------GNLDLYGAAVLFADEPLRSVKNCLKPGTGNNSED-----WS 368
Fly 369 D---SFHNYTLEWTP------------RELR--------------------WLVDGKEWCVQGSA 398
Fly 399 KG----------SFSETTAAG---KSLPQAQKLEEG 421 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GNBP3 | NP_523986.2 | CBM39 | 27..132 | CDD:292510 | |
GH16_beta_GRP | 175..489 | CDD:185688 | 39/231 (17%) | ||
EXGT-A3 | NP_178294.1 | GH16_XET | 29..290 | CDD:185685 | 39/231 (17%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1209387at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |