DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and EXGT-A3

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_178294.1 Gene:EXGT-A3 / 814716 AraportID:AT2G01850 Length:333 Species:Arabidopsis thaliana


Alignment Length:231 Identity:39/231 - (16%)
Similarity:70/231 - (30%) Gaps:101/231 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 RNGRTLNDGLPPMVTAQFSSKDFSFKYGRVEVRAKMPRAQWVTPQIWLQPRRPIYGVDDYRSGQL 323
            ::|:::...|.....:.|.|.|: :.:|......|:|                    .||.:|.:
plant    48 QDGKSVRLTLDERTGSGFVSNDY-YLHGFFSASIKLP--------------------SDYTAGVV 91

  Fly   324 RIAYTRPNG---------------GNLDLYGAAVLFADEPLRSVKNCLKPGTGNNSED-----WS 368
             :|:...||               ||:         .::..|...|....|:.::..:     |.
plant    92 -VAFYMSNGDMYEKNHDEIDFEFLGNI---------REKEWRVQTNIYGNGSTHSGREERYNLWF 146

  Fly   369 D---SFHNYTLEWTP------------RELR--------------------WLVDGKEWCVQGSA 398
            |   .||.|::.|:.            ||::                    |  ||.:|...|..
plant   147 DPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIW--DGSKWATNGGK 209

  Fly   399 KG----------SFSETTAAG---KSLPQAQKLEEG 421
            .|          .||:....|   ..:.|..:.:||
plant   210 YGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510
GH16_beta_GRP 175..489 CDD:185688 39/231 (17%)
EXGT-A3NP_178294.1 GH16_XET 29..290 CDD:185685 39/231 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.