DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and GNBP-like3

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_611483.1 Gene:GNBP-like3 / 37313 FlyBaseID:FBgn0034511 Length:152 Species:Drosophila melanogaster


Alignment Length:130 Identity:65/130 - (50%)
Similarity:83/130 - (63%) Gaps:11/130 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFLLLGVQG----YEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIV 77
            |||:....|    |:||||.:.|..|||||||||||.||:|||||||:||||:.|...|||.|:|
  Fly    11 LFLVAISVGSSLSYDVPKATVKVNSPKGFEVSIPDEPGISLFAFHGKVNEEMDDLSDQTWAADVV 75

  Fly    78 KAKNGRWTFRDRITALKPGDTLYYWTYVIYNGLGYREDDGSFVVN-------GYSGNNASPHPPV 135
            .::|||||:|:|...|:|||.|||||...|:|:.|...:..:||.       ..:|:|....|.|
  Fly    76 SSRNGRWTYRNRNHQLRPGDVLYYWTTARYHGVDYHNYNQRYVVGQGDSQRIDVNGSNGGRQPIV 140

  Fly   136  135
              Fly   141  140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510 58/111 (52%)
GH16_beta_GRP 175..489 CDD:185688
GNBP-like3NP_611483.1 CBM39 26..121 CDD:292510 56/94 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452121
Domainoid 1 1.000 93 1.000 Domainoid score I13957
eggNOG 1 0.900 - - E1_COG2273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105633at50557
OrthoFinder 1 1.000 - - FOG0006727
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.