DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and CG12780

DIOPT Version :10

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster


Alignment Length:91 Identity:50/91 - (54%)
Similarity:62/91 - (68%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VQGYEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIV-KAKNGRWTF 86
            :.||:||.|::.....:||||||.||.||:||.|||:|||.:..|...|||.||: |.|:||||:
  Fly     1 MSGYQVPLARVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTY 65

  Fly    87 RDRITALKPGDTLYYWTYVIYNGLGY 112
            .:|...||.||.|||||.|.|||..|
  Fly    66 TNRDVELKDGDVLYYWTTVRYNGRDY 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:464924 48/87 (55%)
GH16_beta_GRP 175..489 CDD:185688
CG12780NP_610388.1 CBM39 6..97 CDD:464924 48/86 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.