DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP3 and CG12780

DIOPT Version :9

Sequence 1:NP_523986.2 Gene:GNBP3 / 39020 FlyBaseID:FBgn0040321 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster


Alignment Length:91 Identity:50/91 - (54%)
Similarity:62/91 - (68%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VQGYEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIV-KAKNGRWTF 86
            :.||:||.|::.....:||||||.||.||:||.|||:|||.:..|...|||.||: |.|:||||:
  Fly     1 MSGYQVPLARVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTY 65

  Fly    87 RDRITALKPGDTLYYWTYVIYNGLGY 112
            .:|...||.||.|||||.|.|||..|
  Fly    66 TNRDVELKDGDVLYYWTTVRYNGRDY 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP3NP_523986.2 CBM39 27..132 CDD:292510 48/87 (55%)
GH16_beta_GRP 175..489 CDD:185688
CG12780NP_610388.1 CBM39 6..97 CDD:292510 48/86 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105633at50557
OrthoFinder 1 1.000 - - FOG0006727
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.