DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LAG3 and sdk1a

DIOPT Version :9

Sequence 1:NP_002277.4 Gene:LAG3 / 3902 HGNCID:6476 Length:525 Species:Homo sapiens
Sequence 2:XP_009297968.1 Gene:sdk1a / 558391 ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio


Alignment Length:446 Identity:100/446 - (22%)
Similarity:154/446 - (34%) Gaps:147/446 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    18 APVKPLQPGAEVP------VVWAQEGAPAQLPC-SPTIPLQDLSLL-RRAGVTWQHQPDSGPPAA 74
            ||..|:.|...:|      |....|   |.|.| :...|::.|||: ||.||             
Zfish   316 APADPVAPVIVIPPRNTTVVAGISE---ATLECVANARPVEKLSLVWRRNGV------------- 364

Human    75 APGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPA 139
                        ...|..|...||.|:::                                   .
Zfish   365 ------------EVASGVGSFSRRLTIIN-----------------------------------P 382

Human   140 RRADAGEYRAAVHLRDRAL---SCRLRLRLGQAS-MTASP----PGSLRASDWVILNCSFSRPDR 196
            ...|.|.|.....|.|.::   ..|..|.:.:|. .||.|    .|.:..|  |.:.|.......
Zfish   383 TSTDVGMYVCEALLLDSSVKPAEARAFLSITEAPYFTAEPRRKMMGEVEKS--VDIQCQARGVPM 445

Human   197 PASVHWFRNRGQGRVPVRE--SPHHHLAESF-LFLPQVSPMDSGPWGC----------ILTYRDG 248
            | .:.|:::    .||:.:  :|.:.:..|. |.:.::.|.|:|.:.|          :.||.|.
Zfish   446 P-KLEWYKD----AVPLSKLNNPRYKIISSMGLQVRKLQPSDAGIFQCFARNSAGEAQVHTYLDV 505

Human   249 FNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRL-----PAGVGTR--------SFLTAKWTP 300
            .:::..:.      .||..:||..||.:  ...||:     ||.|..|        |....::| 
Zfish   506 TSMAPAFT------APPLDITVTDGAVA--AFTCRVSGAPKPAIVWRRDTQILASGSVQIPRFT- 561

Human   301 PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSP---- 361
                  ||.:|.     |:::.|.....|.|||:....|..:||:.:|.:.:.|  |..||    
Zfish   562 ------LLESGG-----LQIQPVVLQDTGNYTCYAANSEGAINASASLTVWSRT--SISSPPTDR 613

Human   362 ----GSLGKLLCEVT--PVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQL-LSQPW 410
                |:...|.|..|  |..| .|:||...:.....|..|. :..||..| :||.|
Zfish   614 RVIKGTTAILECGATHDPRVG-VRYVWKKDEELVSHSRGGR-ISLQEGSLHISQTW 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LAG3NP_002277.4 Interaction with FGL1. /evidence=ECO:0000269|PubMed:30580966, ECO:0000269|PubMed:9159144 37..252 45/237 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..97 2/34 (6%)
Ig_2 174..259 CDD:290606 19/101 (19%)
IG_like 185..259 CDD:214653 16/86 (19%)
Ig 263..336 CDD:299845 23/85 (27%)
IG_like 267..348 CDD:214653 24/93 (26%)
Connecting peptide. /evidence=ECO:0000250|UniProtKB:Q61790 429..450
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 487..525
KIEELE motif. /evidence=ECO:0000250|UniProtKB:Q61790 498..503
12 X 2 AA tandem repeats of E-X 501..524
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638 23/134 (17%)
I-set 323..412 CDD:254352 27/151 (18%)
I-set 416..505 CDD:254352 20/95 (21%)
Ig 436..500 CDD:299845 12/68 (18%)
I-set 510..600 CDD:254352 27/109 (25%)
Ig 527..600 CDD:299845 21/86 (24%)
I-set 605..693 CDD:254352 20/65 (31%)
Ig 610..693 CDD:299845 17/60 (28%)
FN3 697..788 CDD:238020
fn3 800..886 CDD:278470
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.