DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment orb2 and AT1G73200

DIOPT Version :9

Sequence 1:NP_001356977.1 Gene:orb2 / 39018 FlyBaseID:FBgn0264307 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_177463.1 Gene:AT1G73200 / 843654 AraportID:AT1G73200 Length:779 Species:Arabidopsis thaliana


Alignment Length:344 Identity:66/344 - (19%)
Similarity:109/344 - (31%) Gaps:127/344 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 AMAIAASGN------------DPSVYLNALKMGSPSRLSPHSPHSPIQGGNGGNVGDGTA----- 443
            |:.:||..|            |...||.:|....||.:.|.:..| .:..:.|...||.:     
plant   186 ALRLAACENQERFIWSTKLKEDFRNYLASLNAAYPSFMKPSAGFS-FESLDKGLKADGPSSKVRL 249

  Fly   444 ---RFSRKVFVG-GLPPDIDEDEIT-----------------TSFRRFGPLVVD----------W 477
               :||:|.... ..||.|.:|:.|                 ||.||....:.:          |
plant   250 IWKKFSKKCSTKVNFPPSIRDDKKTSSRSYQDSQSTGSSGKSTSARRMQDNIPEETDVQVISRSW 314

  Fly   478 PHK-------AESKSYFPPKGYAFLLFQDESSVQQLIDSCITDEDKLYLCVSSPTIKDKAVQIRP 535
            .|.       :|.||:            ||.::  .::..::   :|:..|...|:....|:.|.
plant   315 SHSSHASDVDSEDKSF------------DEGTL--ALNVVLS---RLFFDVKQNTVLKNLVRERI 362

  Fly   536 WRLAD----ADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYP 596
            .|:..    ..|:.:....     .|.:|.:|..:..   ..|:.....||....||    ::|.
plant   363 QRIMSNMRIPSYIGELICC-----DVDIGNLPPYIHG---TRILPMEMNGVWAFEID----IEYT 415

  Fly   597 KGAGRVAFSNQQSYIAAISARFVQLQHG-----------------------DIDKRVEVKPYVLD 638
            .|||....:.       :.||...||.|                       |.:|::.|....:|
plant   416 GGAGLEVETR-------VDAREEDLQKGIAEGKLQPNSAGDVPPDLLEGLADFEKQLNVPGGTVD 473

  Fly   639 DQ--------MCDECEGQR 649
            .|        ..||.:|.:
plant   474 AQDVKSGGTDKADESKGPK 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orb2NP_001356977.1 RRM1_CPEB2_like 447..538 CDD:241168 22/125 (18%)
RRM2_CPEB2_like 555..635 CDD:241170 20/102 (20%)
CEBP_ZZ 630..691 CDD:318563 6/28 (21%)
AT1G73200NP_177463.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1113
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.