DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment orb2 and CPEB1

DIOPT Version :9

Sequence 1:NP_001356977.1 Gene:orb2 / 39018 FlyBaseID:FBgn0264307 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001373990.1 Gene:CPEB1 / 64506 HGNCID:21744 Length:593 Species:Homo sapiens


Alignment Length:403 Identity:132/403 - (32%)
Similarity:189/403 - (46%) Gaps:101/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 NGGGDGSNSMSLMQDRMRVM----------GGPKHLSEADAMAIAASGNDPSVYLNALKMGSPSR 420
            :|...||:.:|.:...:|:.          |||:               ||      ||||..||
Human   216 SGFSSGSDHLSDLISSLRISPPLPFLSLSGGGPR---------------DP------LKMGVGSR 259

  Fly   421 LSPH---------SPHSPIQGGNGGN-----------------------------VGDGTAR--- 444
            :...         ||.|..:...|.:                             |.:.|..   
Human   260 MDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSG 324

  Fly   445 -----------FSRKVFVGGLPPDIDEDEITTSFRRFGPLVVDWPHKAESKSYFP-----PKGYA 493
                       :|.|||:||:|.||.|..:..:||.||.|.|:||.|.......|     ||||.
Human   325 QLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYV 389

  Fly   494 FLLFQDESSVQQLIDSCITDE------DKLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLD 552
            :|:|:.|.||:.|:.:|..|.      .:.|..:||..::.|.||:.||.|||:::|...:..||
Human   390 YLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLD 454

  Fly   553 PRKTVFVGGVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISAR 617
            |.:|||||.:...|.|..||.|::.|:|||.|||||||.. |||.|:|||.|:||:||:.|:||.
Human   455 PSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKH-KYPIGSGRVTFNNQRSYLKAVSAA 518

  Fly   618 FVQLQHGDIDKRVEVKPYVLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGR 682
            ||:::.....|:|::.|| |:|.:|..|..|.     .||||.:..|.:|:|..||...||..|.
Human   519 FVEIKTTKFTKKVQIDPY-LEDSLCHICSSQP-----GPFFCRDQVCFKYFCRSCWHWRHSMEGL 577

  Fly   683 EYHKPLVKEGADR 695
            .:|.||::...:|
Human   578 RHHSPLMRNQKNR 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orb2NP_001356977.1 RRM1_CPEB2_like 447..538 CDD:241168 39/101 (39%)
RRM2_CPEB2_like 555..635 CDD:241170 40/79 (51%)
CEBP_ZZ 630..691 CDD:318563 23/60 (38%)
CPEB1NP_001373990.1 CEBP1_N 31..334 CDD:406706 22/138 (16%)
RRM1_CPEB1 336..443 CDD:410122 42/106 (40%)
RRM2_CPEB1 454..537 CDD:410124 44/84 (52%)
CEBP_ZZ 531..586 CDD:406704 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0129
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.