DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp66E and PRPH2

DIOPT Version :10

Sequence 1:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_000313.2 Gene:PRPH2 / 5961 HGNCID:9942 Length:346 Species:Homo sapiens


Alignment Length:232 Identity:45/232 - (19%)
Similarity:79/232 - (34%) Gaps:83/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVL 70
            |:|       :.|:...:.|.|||.:||:|.::......::...||..:     |.::..:..:.
Human    19 GLW-------LMNWFSVLAGIIIFSLGLFLKIELRKRSDVMNNSESHFV-----PNSLIGMGVLS 71

  Fly    71 LVIGAVMFFMSFLG-----YLGAMRESR-----------CLLSTYGTFLILL---LIAEIVAGGL 116
            .|      |.|..|     .|...:.:|           |:|.....||:.|   |:...:...|
Human    72 CV------FNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCFLLRGSLENTL 130

  Fly   117 GAFFKDKVR------AESKNFLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHD-FDASP 174
            |...|:.::      ...:.|::.||                :.|...|.|||.|.:.| |:.. 
Human   131 GQGLKNGMKYYRDTDTPGRCFMKKTI----------------DMLQIEFKCCGNNGFRDWFEIQ- 178

  Fly   175 AWVNG--------------KGN-------RTIPDACC 190
             |::.              |.|       ..:|.:||
Human   179 -WISNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp66ENP_523985.1 Tetraspanin 11..257 CDD:459767 43/227 (19%)
tetraspanin_LEL 120..228 CDD:351888 18/99 (18%)
PRPH2NP_000313.2 Tetraspanin 16..181 CDD:459767 40/197 (20%)
peripherin_like_LEL 120..262 CDD:239415 21/113 (19%)
Interaction with MREG. /evidence=ECO:0000250 341..346
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.