DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp66E and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:238 Identity:62/238 - (26%)
Similarity:94/238 - (39%) Gaps:66/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CGVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYV 69
            |.....:|:||:.:.|..:.|.::...|.||         |..|.|.:|:......   |.||.|
  Fly     3 CTTRLLRYVLCVISGICALGGCLLIWYGAWL---------LDSLSEEQRMLGMDHG---EDLAAV 55

  Fly    70 LLV-IGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQ 133
            |.| :|.|:...|..|.:...::||.||..|...|:.|||.:||...:.       .|.|::||.
  Fly    56 LCVLLGTVIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSIS-------YAASRDFLP 113

  Fly   134 TTITSYSLGENVDATSLMWN-QLMGN---------FGCCGIN---DYHDFDASPAWVNGKGNRTI 185
            .     ||.:.:|.   :|: |..||         ..|||.|   ||...:..|           
  Fly   114 D-----SLRQGLDD---LWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMP----------- 159

  Fly   186 PDACCILKDVAKLVPRDEDCTTNPSDSNSFYKKGCYEVFTEWL 228
            |.:||:          :.|||.:    .:.:..||...|.|::
  Fly   160 PPSCCL----------NRDCTKH----LNLFMTGCEVKFKEYV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 61/234 (26%)
uroplakin_I_like_LEL 116..231 CDD:239409 28/126 (22%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 61/233 (26%)
tetraspanin_LEL 109..192 CDD:239401 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.