| Sequence 1: | NP_001261600.1 | Gene: | TrpA1 / 39015 | FlyBaseID: | FBgn0035934 | Length: | 1232 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_015085.1 | Gene: | YAR1 / 855837 | SGDID: | S000006160 | Length: | 200 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 245 | Identity: | 57/245 - (23%) |
|---|---|---|---|
| Similarity: | 90/245 - (36%) | Gaps: | 71/245 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 395 GADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQV 459
Fly 460 ANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRS----LENLIR------LGACINLKNNNNES 514
Fly 515 PLHFAARYGRYNTVRQLLDS-EKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDH 578
Fly 579 ------TGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLAT 622 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TrpA1 | NP_001261600.1 | Ank_2 | 95..188 | CDD:289560 | |
| ANK | 121..246 | CDD:238125 | |||
| ANK repeat | 125..155 | CDD:293786 | |||
| ANK repeat | 157..199 | CDD:293786 | |||
| Ank_2 | 230..330 | CDD:289560 | |||
| ANK repeat | 259..298 | CDD:293786 | |||
| ANK | 298..425 | CDD:238125 | 6/29 (21%) | ||
| ANK repeat | 300..330 | CDD:293786 | |||
| Ank_2 | 305..402 | CDD:289560 | 1/6 (17%) | ||
| ANK repeat | 336..369 | CDD:293786 | |||
| ANK repeat | 374..402 | CDD:293786 | 1/6 (17%) | ||
| ANK repeat | 404..476 | CDD:293786 | 12/71 (17%) | ||
| ANK | 473..599 | CDD:238125 | 37/142 (26%) | ||
| ANK repeat | 478..509 | CDD:293786 | 12/40 (30%) | ||
| Ank_2 | 483..572 | CDD:289560 | 28/99 (28%) | ||
| ANK repeat | 511..545 | CDD:293786 | 11/34 (32%) | ||
| ANK | 542..662 | CDD:238125 | 17/87 (20%) | ||
| ANK repeat | 547..576 | CDD:293786 | 4/28 (14%) | ||
| Ank_2 | 552..643 | CDD:289560 | 15/77 (19%) | ||
| ANK repeat | 579..611 | CDD:293786 | 6/31 (19%) | ||
| ANK repeat | 613..638 | CDD:293786 | 3/10 (30%) | ||
| Ion_trans | 858..1074 | CDD:278921 | |||
| YAR1 | NP_015085.1 | ANK repeat | 11..47 | CDD:293786 | 11/68 (16%) |
| Ank_2 | 20..124 | CDD:403870 | 35/139 (25%) | ||
| ANK repeat | 49..90 | CDD:293786 | 14/43 (33%) | ||
| ANK repeat | 92..124 | CDD:293786 | 10/31 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2336 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.030 | |||||