DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpA1 and DYSF

DIOPT Version :9

Sequence 1:NP_001261600.1 Gene:TrpA1 / 39015 FlyBaseID:FBgn0035934 Length:1232 Species:Drosophila melanogaster
Sequence 2:XP_005264641.1 Gene:DYSF / 8291 HGNCID:3097 Length:2133 Species:Homo sapiens


Alignment Length:445 Identity:87/445 - (19%)
Similarity:143/445 - (32%) Gaps:162/445 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LEAILPAE----PPAEV----------------CLLRD------SPFRILRAAESGNLDDFKRLF 111
            :|.:||.|    ||..|                |.:|.      .|:.....:..|..||...|.
Human  1419 MEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLS 1483

  Fly   112 MADNSRIALKD----------------AKGRTAAHQAAARNRVNILRYI------------RDQN 148
            ..::..|.:.|                |...||:..::....    .:|            |::.
Human  1484 PGEDVLIDIDDKEPLIPIQLADGLSSLAPTNTASPPSSPHEE----EFIDWWSKFFASIGEREKC 1544

  Fly   149 GDFNAKD----NAGNTPLHIAVESDAYDAL-DYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLR 208
            |.:..||    ...:|.|.   ..:|::.| |:..:..:..|...|:.:.|             .
Human  1545 GSYLEKDFDTLKVYDTQLE---NVEAFEGLSDFCNTFKLYRGKTQEETEDP-------------S 1593

  Fly   209 VMGQYRNVIDIQQGGEHGRTAL-----HLAAIYDHEEC-ARI-LITEFDACPRKPCNNG----YY 262
            |:|:::.:..|....|.....:     |..|....:|| .|| ::..|...|:.|  ||    |.
Human  1594 VIGEFKGLFKIYPLPEDPAIPMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDP--NGKCDPYI 1656

  Fly   263 PIHEAAKNASSK------TMEVFFQWGEQRGCT----REEMISFYD----------SEGNVPLHS 307
            .|....|:.|.:      |:|..|....:..||    ::..|:.||          .|..|.|.:
Human  1657 KISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLEN 1721

  Fly   308 AVHGGDIKAVELCLKSGAKIS-TQQHDLSTP------------VHLACAQGAIDIV-----KLMF 354
                      .|..|.||:.. .|.:.:|.|            :||.|.|..:...     ::||
Human  1722 ----------RLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMF 1776

  Fly   355 E------------------MQPMEKRLCLSCTDVQKMTPLHCAS--MFD--HPDI 387
            :                  :.|:|:||.|.....|.:.|.|..|  ::.  .|||
Human  1777 QDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDI 1831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpA1NP_001261600.1 Ank_2 95..188 CDD:289560 20/125 (16%)
ANK 121..246 CDD:238125 27/164 (16%)
ANK repeat 125..155 CDD:293786 5/41 (12%)
ANK repeat 157..199 CDD:293786 8/42 (19%)
Ank_2 230..330 CDD:289560 30/131 (23%)
ANK repeat 259..298 CDD:293786 12/52 (23%)
ANK 298..425 CDD:238125 29/140 (21%)
ANK repeat 300..330 CDD:293786 7/30 (23%)
Ank_2 305..402 CDD:289560 26/123 (21%)
ANK repeat 336..369 CDD:293786 12/67 (18%)
ANK repeat 374..402 CDD:293786 6/18 (33%)
ANK repeat 404..476 CDD:293786
ANK 473..599 CDD:238125
ANK repeat 478..509 CDD:293786
Ank_2 483..572 CDD:289560
ANK repeat 511..545 CDD:293786
ANK 542..662 CDD:238125
ANK repeat 547..576 CDD:293786
Ank_2 552..643 CDD:289560
ANK repeat 579..611 CDD:293786
ANK repeat 613..638 CDD:293786
Ion_trans 858..1074 CDD:278921
DYSFXP_005264641.1 C2A_Ferlin 5..134 CDD:176019
C2B_Ferlin 249..358 CDD:175978
FerI 356..406 CDD:285377
C2C_Ferlin 412..586 CDD:175985
FerA 730..787 CDD:285389
FerB 819..891 CDD:285376
DysFN 907..965 CDD:214777
DysFN 978..1034 CDD:214777
C2D_Ferlin 1184..1312 CDD:175984
C2E_Ferlin 1632..1755 CDD:176002 29/134 (22%)
C2F_Ferlin 1866..1997 CDD:176020
Ferlin_C 2010..>2096 CDD:292783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1326
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.