DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpA1 and SOWAHC

DIOPT Version :9

Sequence 1:NP_001261600.1 Gene:TrpA1 / 39015 FlyBaseID:FBgn0035934 Length:1232 Species:Drosophila melanogaster
Sequence 2:NP_075392.2 Gene:SOWAHC / 65124 HGNCID:26149 Length:525 Species:Homo sapiens


Alignment Length:163 Identity:46/163 - (28%)
Similarity:79/163 - (48%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 EKDSMG-----CSPLHYA----SRDGHIRSLENLIRLGACINLKNN--NNESPLHFAARYGRYNT 527
            |::|.|     ..||.:|    :.||...|||.|:.....:.:|.:  ...:.||:||::||...
Human   253 EEESSGGGSVTLDPLEHAWMLSASDGKWDSLEGLLTCEPGLLVKRDFITGFTCLHWAAKHGRQEL 317

  Fly   528 VRQLLD-SEKGSFIIN--ESDGAGMTPLHISSQQGHTRVVQLLLNRGA----LLHRDHTGRNPLQ 585
            :..|:: :.|....:|  .....|.|.||:::..||..||:||:  ||    :..||::|:...|
Human   318 LAMLVNFANKHQLPVNIDARTSGGYTALHLAAMHGHVEVVKLLV--GAYDADVDIRDYSGKKASQ 380

  Fly   586 LAAMSGYTETIELLHSVHSHLLDQVDK-DGNTA 617
            ..:.| ..|.|:       :|:..:|: ||.:|
Human   381 YLSRS-IAEEIK-------NLVGALDEGDGESA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpA1NP_001261600.1 Ank_2 95..188 CDD:289560
ANK 121..246 CDD:238125
ANK repeat 125..155 CDD:293786
ANK repeat 157..199 CDD:293786
Ank_2 230..330 CDD:289560
ANK repeat 259..298 CDD:293786
ANK 298..425 CDD:238125
ANK repeat 300..330 CDD:293786
Ank_2 305..402 CDD:289560
ANK repeat 336..369 CDD:293786
ANK repeat 374..402 CDD:293786
ANK repeat 404..476 CDD:293786 1/1 (100%)
ANK 473..599 CDD:238125 41/142 (29%)
ANK repeat 478..509 CDD:293786 10/39 (26%)
Ank_2 483..572 CDD:289560 28/97 (29%)
ANK repeat 511..545 CDD:293786 9/36 (25%)
ANK 542..662 CDD:238125 25/83 (30%)
ANK repeat 547..576 CDD:293786 12/32 (38%)
Ank_2 552..643 CDD:289560 22/71 (31%)
ANK repeat 579..611 CDD:293786 6/31 (19%)
ANK repeat 613..638 CDD:293786 3/5 (60%)
Ion_trans 858..1074 CDD:278921
SOWAHCNP_075392.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..263 3/9 (33%)
Ank_2 272..372 CDD:289560 28/101 (28%)
ANK 301..>375 CDD:238125 23/75 (31%)
ANK 1 301..330 8/28 (29%)
ANK repeat 302..338 CDD:293786 9/35 (26%)
ANK repeat 340..372 CDD:293786 12/33 (36%)
ANK 2 340..370 12/31 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.