| Sequence 1: | NP_001261600.1 | Gene: | TrpA1 / 39015 | FlyBaseID: | FBgn0035934 | Length: | 1232 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001099046.1 | Gene: | SOWAHD / 347454 | HGNCID: | 32960 | Length: | 315 | Species: | Homo sapiens |
| Alignment Length: | 218 | Identity: | 54/218 - (24%) |
|---|---|---|---|
| Similarity: | 94/218 - (43%) | Gaps: | 45/218 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 400 ALDKEHRSP--LLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANC 462
Fly 463 QTQAQLKLLLNEKDSMGCSPLH---YASRDGHIRSLENLIRLGACINLKNN--NNESPLHFAARY 522
Fly 523 GRYNTVRQLLD--SEKGSFI-INESDGAGMTPLHISSQQGHTRVVQLLLNRGAL----LHRDHTG 580
Fly 581 RN---------PLQLAAMSGYTE 594 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TrpA1 | NP_001261600.1 | Ank_2 | 95..188 | CDD:289560 | |
| ANK | 121..246 | CDD:238125 | |||
| ANK repeat | 125..155 | CDD:293786 | |||
| ANK repeat | 157..199 | CDD:293786 | |||
| Ank_2 | 230..330 | CDD:289560 | |||
| ANK repeat | 259..298 | CDD:293786 | |||
| ANK | 298..425 | CDD:238125 | 9/26 (35%) | ||
| ANK repeat | 300..330 | CDD:293786 | |||
| Ank_2 | 305..402 | CDD:289560 | 1/1 (100%) | ||
| ANK repeat | 336..369 | CDD:293786 | |||
| ANK repeat | 374..402 | CDD:293786 | 1/1 (100%) | ||
| ANK repeat | 404..476 | CDD:293786 | 17/73 (23%) | ||
| ANK | 473..599 | CDD:238125 | 36/143 (25%) | ||
| ANK repeat | 478..509 | CDD:293786 | 6/33 (18%) | ||
| Ank_2 | 483..572 | CDD:289560 | 24/96 (25%) | ||
| ANK repeat | 511..545 | CDD:293786 | 8/36 (22%) | ||
| ANK | 542..662 | CDD:238125 | 22/66 (33%) | ||
| ANK repeat | 547..576 | CDD:293786 | 13/32 (41%) | ||
| Ank_2 | 552..643 | CDD:289560 | 19/56 (34%) | ||
| ANK repeat | 579..611 | CDD:293786 | 6/25 (24%) | ||
| ANK repeat | 613..638 | CDD:293786 | |||
| Ion_trans | 858..1074 | CDD:278921 | |||
| SOWAHD | NP_001099046.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||
| ANK 1 | 112..141 | 5/35 (14%) | |||
| ANK | 147..>231 | CDD:238125 | 25/85 (29%) | ||
| ANK 2 | 147..162 | 6/14 (43%) | |||
| Ank_2 | <148..218 | CDD:289560 | 21/71 (30%) | ||
| ANK repeat | 148..184 | CDD:293786 | 8/35 (23%) | ||
| ANK repeat | 186..218 | CDD:293786 | 13/33 (39%) | ||
| ANK 3 | 186..216 | 13/31 (42%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2336 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.030 | |||||