DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TrpA1 and MYOF

DIOPT Version :9

Sequence 1:	NP_001261600.1	Gene:	TrpA1 / 39015	FlyBaseID:	FBgn0035934	Length:	1232	Species:	Drosophila melanogaster
Sequence 2:	XP_005269750.1	Gene:	MYOF / 26509	HGNCID:	3656	Length:	2080	Species:	Homo sapiens

Alignment Length:	138	Identity:	34/138 - (24%)
Similarity:	57/138 - (41%)	Gaps:	45/138 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly  1068 SVRRNAQLKRLAMQVVLHTELE------------RKLPHVWLQRVDKMELIEYPNETKCKLGFCD 1120
            |.|.:|....|||...|.|.:|            .:|..:||:.:|  |:||   :|:
Human   651 SHRLDAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLID--EVIE---DTR------- 703

  Fly  1121 FILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHH-LVRLIVQKMEIK 1184
                  ::.|.||..:...:            |:.|.||||  ||.|.|.|. .||:..:..::|
Human   704 ------YTLPLTEGKANVTV------------LDTQIRKLR--SRSLSQIHEAAVRMRSEATDVK 748

  Fly  1185 TEADDVDE 1192
            :...::::
Human   749 STLAEIED 756

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TrpA1	NP_001261600.1	Ank_2	95..188	CDD:289560
		ANK	121..246	CDD:238125
		ANK repeat	125..155	CDD:293786
		ANK repeat	157..199	CDD:293786
		Ank_2	230..330	CDD:289560
		ANK repeat	259..298	CDD:293786
		ANK	298..425	CDD:238125
		ANK repeat	300..330	CDD:293786
		Ank_2	305..402	CDD:289560
		ANK repeat	336..369	CDD:293786
		ANK repeat	374..402	CDD:293786
		ANK repeat	404..476	CDD:293786
		ANK	473..599	CDD:238125
		ANK repeat	478..509	CDD:293786
		Ank_2	483..572	CDD:289560
		ANK repeat	511..545	CDD:293786
		ANK	542..662	CDD:238125
		ANK repeat	547..576	CDD:293786
		Ank_2	552..643	CDD:289560
		ANK repeat	579..611	CDD:293786
		ANK repeat	613..638	CDD:293786
		Ion_trans	858..1074	CDD:278921	2/5 (40%)
MYOF	XP_005269750.1	C2A_Ferlin	5..136	CDD:176019
		C2B_Ferlin	196..305	CDD:175978
		FerI	303..353	CDD:285377
		C2C_Ferlin	359..535	CDD:175985
		FerA	680..737	CDD:285389	22/88 (25%)
		FerB	769..841	CDD:285376
		DysFN	856..914	CDD:214777
		DysFN	927..983	CDD:214777
		C2D_Ferlin	1139..1272	CDD:175984
		C2	1327..>1403	CDD:301316
		C2E_Ferlin	1573..1696	CDD:176002
		C2F_Ferlin	1809..1940	CDD:176020
		Ferlin_C	1956..2044	CDD:292783
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1326
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900