DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpA1 and Sowahd

DIOPT Version :9

Sequence 1:NP_001261600.1 Gene:TrpA1 / 39015 FlyBaseID:FBgn0035934 Length:1232 Species:Drosophila melanogaster
Sequence 2:NP_776140.1 Gene:Sowahd / 245381 MGIID:3045274 Length:327 Species:Mus musculus


Alignment Length:219 Identity:56/219 - (25%)
Similarity:82/219 - (37%) Gaps:84/219 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 LDKEHRSPLLLAASRS---GWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANC 462
            |.:||..|.:..:.||   |...|        |:..::       |..|:          ..|.|
Mouse    88 LSEEHLEPAVPGSRRSSGQGSSRV--------CLEPRE-------HAWIL----------AAAEC 127

  Fly   463 Q-------TQAQLKLLLNEKDSMGCSPLHYASRDG-HIRSLENLIRLGACINLKNNNNESPLH-F 518
            :       .:|:..||:.|....|.|.||:.::.| |    |.||.               || |
Mouse   128 RFEVLLEMLEAEPSLLMREDPITGYSVLHWLAKHGRH----EELIL---------------LHDF 173

  Fly   519 AARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGAL----LHRDHT 579
            |.|.|.             .|.::.....|:||||:::.|||..|:::|:  |||    ..|||:
Mouse   174 ARRRGL-------------PFDVSAPGSGGLTPLHLAALQGHDMVIKVLV--GALGADPSRRDHS 223

  Fly   580 GRNP---------LQLAAMSGYTE 594
            |..|         |.|..:||..|
Mouse   224 GNRPCHYLRPDASLNLRELSGAEE 247

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TrpA1NP_001261600.1 Ank_2 95..188 CDD:289560
ANK 121..246 CDD:238125
ANK repeat 125..155 CDD:293786
ANK repeat 157..199 CDD:293786
Ank_2 230..330 CDD:289560
ANK repeat 259..298 CDD:293786
ANK 298..425 CDD:238125 8/26 (31%)
ANK repeat 300..330 CDD:293786