DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpA1 and Ank1

DIOPT Version :9

Sequence 1:NP_001261600.1 Gene:TrpA1 / 39015 FlyBaseID:FBgn0035934 Length:1232 Species:Drosophila melanogaster
Sequence 2:XP_006509052.1 Gene:Ank1 / 11733 MGIID:88024 Length:1950 Species:Mus musculus


Alignment Length:649 Identity:170/649 - (26%)
Similarity:267/649 - (41%) Gaps:135/649 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PAEPPAEVCLL---------RDSPFRILRAAESGNLD---DFKRLFMADNS---------RIALK 121
            |:.|||...|:         .|:....||||.|||||   |..|..:..|:         .:|.|
Mouse    41 PSSPPAGRVLVPSNKMGFCKADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASK 105

  Fly   122 DA--------------------KGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAV 166
            :.                    ||.||.|.||...:..::|.:.:...:.||:...|.|||::|.
Mouse   106 EGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAA 170

  Fly   167 ESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRT--- 228
            :.:..:.:.:||....:..|..|....|:.:|.:         .|....|..:...|..|:.   
Mouse   171 QENHLEVVKFLLENGANQNVATEDGFTPLAVALQ---------QGHENVVAHLINYGTKGKVRLP 226

  Fly   229 ALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEM 293
            |||:||..|....|.:|: :.|..|......|:.|:|.||...:....::..    .||.:    
Mouse   227 ALHIAARNDDTRTAAVLL-QNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLL----NRGAS---- 282

  Fly   294 ISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEM-Q 357
            ::|....|..|||.|...|::..|.|.|..||:|.|:..|..||:|.|...|.:.|.:::.:. .
Mouse   283 VNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGA 347

  Fly   358 PMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVH 422
            |::.:      ....::|:|.|:..||.|.|..|:...|:|:.:..:|.:||.:||.....:...
Mouse   348 PIQAK------TKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAK 406

  Fly   423 LLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQ--AQLKLLLNEKDSM------G 479
            :|:..||                ..|...|..|......|:..  ..::|||....|:      |
Mouse   407 VLLDKGA----------------KPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESG 455

  Fly   480 CSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINES 544
            .:|||.||..||:..::||::.||..|:.|...|:|||.|||.|.....:.||.::..:   |..
Mouse   456 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKA---NAK 517

  Fly   545 DGAGMTPLHISSQQGHTRVVQLLLNRG---------------------------ALLHRDHT--- 579
            .....||||.:::.|||.:|:|||..|                           |||.::.:   
Mouse   518 AKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQAC 582

  Fly   580 ----GRNPLQLAAMSGYTETIELL--HSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMG 637
                |..||.:||..|.....|||  |..|.   :...|:|.|.||:|...|....:.:|:..|
Mouse   583 MTKKGFTPLHVAAKYGKVRLAELLLEHDAHP---NAAGKNGLTPLHVAVHHNNLDIVKLLLPRG 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpA1NP_001261600.1 Ank_2 95..188 CDD:289560 32/124 (26%)
ANK 121..246 CDD:238125 33/147 (22%)
ANK repeat 125..155 CDD:293786 9/29 (31%)
ANK repeat 157..199 CDD:293786 10/41 (24%)
Ank_2 230..330 CDD:289560 29/99 (29%)
ANK repeat 259..298 CDD:293786 8/38 (21%)
ANK 298..425 CDD:238125 36/127 (28%)
ANK repeat 300..330 CDD:293786 12/29 (41%)
Ank_2 305..402 CDD:289560 29/97 (30%)
ANK repeat 336..369 CDD:293786 7/33 (21%)
ANK repeat 374..402 CDD:293786 10/27 (37%)
ANK repeat 404..476 CDD:293786 15/73 (21%)
ANK 473..599 CDD:238125 48/165 (29%)
ANK repeat 478..509 CDD:293786 13/36 (36%)
Ank_2 483..572 CDD:289560 35/115 (30%)
ANK repeat 511..545 CDD:293786 11/33 (33%)
ANK 542..662 CDD:238125 36/132 (27%)
ANK repeat 547..576 CDD:293786 15/55 (27%)
Ank_2 552..643 CDD:289560 33/122 (27%)
ANK repeat 579..611 CDD:293786 11/40 (28%)
ANK repeat 613..638 CDD:293786 8/25 (32%)
Ion_trans 858..1074 CDD:278921
Ank1XP_006509052.1 ANK repeat 454..485 CDD:293786 13/30 (43%)
ANK repeat 487..518 CDD:293786 11/33 (33%)
ANK repeat 520..549 CDD:293786 12/28 (43%)
ANK repeat 554..584 CDD:293786 3/29 (10%)
ANK repeat 586..617 CDD:293786 11/33 (33%)
Ank_2 597..>810 CDD:393464 15/50 (30%)
ANK repeat 619..647 CDD:293786 8/25 (32%)
ANK repeat 652..682 CDD:293786
ANK repeat 685..716 CDD:293786
ANK repeat 718..749 CDD:293786
ANK repeat 751..782 CDD:293786
ANK repeat 784..812 CDD:293786
Ank_4 785..837 CDD:372654
ZU5 970..1074 CDD:128514
UPA_2 1295..1424 CDD:375346
Death_ank1 1460..1543 CDD:260067
ANK repeat 65..93 CDD:293786 12/27 (44%)
Ank_2 67..158 CDD:372319 23/90 (26%)
ANK repeat 95..126 CDD:293786 2/30 (7%)
ANK repeat 129..159 CDD:293786 9/29 (31%)
PHA02876 <141..>486 CDD:165207 96/384 (25%)
ANK repeat 161..192 CDD:293786 8/30 (27%)
ANK repeat 194..218 CDD:293786 4/32 (13%)
ANK repeat 227..254 CDD:293786 10/27 (37%)
ANK repeat 257..287 CDD:293786 8/37 (22%)
ANK repeat 289..320 CDD:293786 13/30 (43%)
ANK repeat 322..353 CDD:293786 8/36 (22%)
ANK repeat 355..386 CDD:293786 10/30 (33%)
ANK repeat 391..419 CDD:293786 8/43 (19%)
ANK repeat 421..452 CDD:293786 6/30 (20%)
PHA02875 433..>643 CDD:165206 63/215 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.