DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcm7 and Mcm9

DIOPT Version :9

Sequence 1:NP_523984.1 Gene:Mcm7 / 39014 FlyBaseID:FBgn0020633 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_082106.3 Gene:Mcm9 / 71567 MGIID:1918817 Length:1134 Species:Mus musculus


Alignment Length:647 Identity:194/647 - (29%)
Similarity:318/647 - (49%) Gaps:115/647 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VIAELLPSYKQQEVHAKDALDVYIEHRLMMESRTRNP---------------MEQRDERNSFPSE 129
            ::.::..|| ..|.|..|.|       |:::.|..:.               ||..|....||:|
Mouse     8 LVGQVFESY-VSEYHKNDIL-------LILKERDEDAHYPVVVNAMSLFETNMEIGDYFTVFPNE 64

  Fly   130 LMKRFEVGFKPLSTEKAHSIREV----------------------------KAQHIGKLVTVRGI 166
            ::..|:...:..:.....|:.|.                            |.:.:|..::|.|.
Mouse    65 VLTVFDSALRRSALAILQSLPETEGLSMKQNLHARISGLPVCPELVREHIPKTKDVGHFLSVTGT 129

  Fly   167 VTRCTEVKPMMVVATYTCDRC--------GSETYQPVNSLSFTPVHDCPS-DDCRVNKAGGRLYL 222
            |.|.:.||.:.....|.|::|        ..|.|     .:|:....||| ..|..:|......|
Mouse   130 VIRTSLVKVLEFERDYMCNKCKHVFMVEADFEQY-----YTFSRPSSCPSLASCDSSKFSCLSDL 189

  Fly   223 QTRGSKFVKFQEVKMQEHSDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFL----PLMRT 283
            .:..::...:||:|:||...::.||.|||||.::...::....:.||.:.:.||.:    |..|.
Mouse   190 SSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKVILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRD 254

  Fly   284 GFAQMIQGLLSETFLQAHRIICINKNDE--ISDKDAELTPEELEELAQDDFYE-----------R 335
            ...::      |..|:|:.:...|:...  :.|:|   |.:|.|     ||:|           .
Mouse   255 VRCEV------EIVLKANYVQVNNEQSSGMVMDED---TRKEFE-----DFWEHYKSDPFAGRNE 305

  Fly   336 LATSLAPEIYGHLDVKKALLLLLVGGVDKRPD--GMKIRGNINICLMGDPGVAKSQLLGYISRLA 398
            :..||.|:::|...||.|:.::|.||: :|.|  |.::||..::.|:||||..|||.|.|.:::.
Mouse   306 ILASLCPQVFGMYLVKLAVAMVLAGGI-QRTDAAGTRVRGESHLLLVGDPGTGKSQFLKYAAKIT 369

  Fly   399 VRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVME 463
            .||..|||.||:..|||...:||  :||..||.|||||||.|:||||||:.:.:.|||:|||.||
Mouse   370 PRSVLTTGIGSTSAGLTVTAVKD--SGEWNLEAGALVLADAGLCCIDEFNSLKEHDRTSIHEAME 432

  Fly   464 QQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRD 528
            |||||:||||::..||.|.:||||.||. |:|:|:.:|..||.|.:.|||||||:.::.|..:.|
Mouse   433 QQTISVAKAGLVCKLNTRTTILAATNPK-GQYDPKESVSVNIALGSPLLSRFDLVLVLLDTRNED 496

  Fly   529 NDLRLAKHITYVHSHSKQPPTRVKAL-DMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREA 592
            .|..::..|.    .:|..|::.:.| .|..|:.|..|.:..:||: .|:::.::..|.:::|::
Mouse   497 WDRIISSFIL----ENKGYPSKSENLWSMEKMKTYFCLIRNLHPTL-SEVSNQVLLRYYQMQRQS 556

  Fly   593 RNQKDMTFTSARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKD------SLNQIH 648
             :.::...|:.|.|..::||:.|.|||....:|..:|...|:.::|.|..      .:|.:|
Mouse   557 -DSRNAARTTIRLLESLIRLAEAHARLMFRSAVTLEDAVTAVSVMESSMQGGALLGGVNALH 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcm7NP_523984.1 MCM_N 13..97 CDD:379644 4/16 (25%)
MCM 145..641 CDD:214631 176/552 (32%)
Mcm9NP_082106.3 Mcm2 10..605 CDD:224162 192/631 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..1101
DUF4045 <739..>1004 CDD:330572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.