DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcm7 and Mcmdc2

DIOPT Version :9

Sequence 1:NP_523984.1 Gene:Mcm7 / 39014 FlyBaseID:FBgn0020633 Length:720 Species:Drosophila melanogaster
Sequence 2:XP_006237843.1 Gene:Mcmdc2 / 500392 RGDID:1561068 Length:689 Species:Rattus norvegicus


Alignment Length:688 Identity:138/688 - (20%)
Similarity:229/688 - (33%) Gaps:190/688 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ELLPSYKQQEVHAKDALDVYIE-----HRLMMESRTRNPMEQRDERNSFPSELMKRFEVGFKP-- 140
            |:....|..::..|:|..||::     .:.|.:.:..|..:|        |..:.||.:...|  
  Rat     2 EITNMEKMGKLPMKEAALVYLDRSGGLQKFMDDCKYYNDSKQ--------SYAVYRFSILINPCD 58

  Fly   141 ---LSTEKAHSI--REVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRCGS-ETYQPVN-SL 198
               |..|..:.|  ..:||..:.:.|        |       .||..|....|. :|...:| .|
  Rat    59 VVELDAELGNHILHHPLKAAQVFQSV--------C-------FVAVKTLSLIGKLQTETQINIVL 108

  Fly   199 SFTPVHDCPS---DDCR--VNKAGGRLYLQ-------------TRGSKFVKFQEVKMQEHSDQVP 245
            ..|.:...||   |.|.  :|.|..|.|:.             |:|::|:...||.......|..
  Rat   109 KLTHLPSLPSYSLDLCEFPLNYASQRFYMMQGIVIAMTTVTKYTQGARFLCSDEVCPFSKGFQYI 173

  Fly   246 VGHIP---RSMTI----MCR------GEVTRMAQPGDHIVVS----------------------- 274
            ..|:|   .|.|:    :||      .|..:....||..::.                       
  Rat   174 RVHVPGATESATVRNDFLCRLCSSSLQEDRKFRVLGDKQIIEIITTKVLHAFQGDPKNQPFRFQS 238

  Fly   275 -GVFL-----PLMRTGFAQMIQGL-----LSETFLQAHRIICINKNDEISDKDAELTP--EELEE 326
             .|||     ..|:.|....|.|:     .|:|.|      |:..|        .:||  .::..
  Rat   239 LSVFLRDELVNKMKIGNEYKIIGIPVCVKTSQTAL------CVEAN--------SITPYTAKVPS 289

  Fly   327 LAQDDFYERLA---------TSLAPEIY-------GHLDVKKALLLLLVGGVDKRPDGMKIRGNI 375
            ...|:|...|:         |::...::       |..::.|  |.||:..|..|....:....:
  Rat   290 GISDNFRCLLSLTSSSCWRFTAILANVFASHIVPLGTYNLLK--LCLLMSLVQTRDCSSERENCL 352

  Fly   376 NICLMGDPGVAKSQLLGYISRLAVRSQY---------TTGRGSSGVGLTAAVMKDPLTGEMTLEG 431
            :|.::....:...:||.:...|..|...         |..|...|            ||.::::.
  Rat   353 DILVITSDTLLVDRLLNFSMNLVSRGIRHPVCTEVFPTVSRDKYG------------TGAVSIQA 405

  Fly   432 GALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAG--------------IMTTLNARV 482
            |:.:||..|||.|.:...........:...:|.:::::...|              |..:..:.|
  Rat   406 GSALLARGGVCFIGDLTSHKKDKLEQLQSALESRSVTVFIPGKKFGDDFDQQMTFPIQCSFWSFV 470

  Fly   483 SILAAANPAFGRYNPRRTVEQNIQL---------PAALLSRFDLLWLIQDKPDRDNDLRLAKHIT 538
            .:.:::         ||.|::...|         ||.|...|.||...::.......|...:|..
  Rat   471 DMDSSS---------RRNVQKASTLIGQMDCSLIPANLAEAFGLLVNCKESSPCHPLLPTVQHTL 526

  Fly   539 YVHSHSKQPP-TRVKALDMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREARNQKDMTFTS 602
            ......|.|| ...|........:.:...|..|.....|....|.|.|:..||...:....:..|
  Rat   527 KKAVDPKGPPYLASKQFTTEDFEKLLAFAKNLNVEFSLEAERMIHGYYLASRRIRTDSIHGSKLS 591

  Fly   603 ARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMS 640
            |..|..::.||.|.|||.|.:.|.::||..|..|.|:|
  Rat   592 ANALKYLVSLSEAHARLNLRNKVLREDVLIAALLFEIS 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcm7NP_523984.1 MCM_N 13..97 CDD:379644 2/13 (15%)
MCM 145..641 CDD:214631 123/616 (20%)
Mcmdc2XP_006237843.1 MCM <389..630 CDD:278895 57/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.