DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dally and C03H12.1

DIOPT Version :9

Sequence 1:NP_001246685.1 Gene:dally / 39013 FlyBaseID:FBgn0263930 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_510583.2 Gene:C03H12.1 / 181659 WormBaseID:WBGene00007284 Length:731 Species:Caenorhabditis elegans


Alignment Length:449 Identity:81/449 - (18%)
Similarity:154/449 - (34%) Gaps:138/449 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GVLETNAKQFQSHVLELAQISENMTHSLFSKVYTRM-VPSSRMMIHQLYTEIMNHLIYTSNYTNS 191
            ||....:.|      :|..:|:|  |.|.:.:|.:: .|..:......::::..|  |.....|:
 Worm   240 GVFRLQSAQ------DLTTLSKN--HDLLTILYFKIKTPPQKFQSASNFSKLAYH--YLDGDPNT 294

  Fly   192 NGQLGRRGIGSVQSNLEEAVRHFFVQLFPVAYHQMVHLSKN-----------NLGDLHEDYVNCL 245
            :     |.|..:.::.:.|.:   :||.  ..|.:|.:|..           .:.::|:|.|...
 Worm   295 D-----RTIFCIVTDSQLAAQ---LQLH--NEHDLVLVSSELKLLTTHYKGWVMENVHKDLVKFS 349

  Fly   246 QH----NFDEMHPFGDIPQQVQSNLGKSVHMSNVFMNALLQAAEVLSEADAL--------YGEQL 298
            |.    |.:.:            |||:..|.:        |.||..::...|        ||...
 Worm   350 QEAAMKNVEFL------------NLGRRFHST--------QLAEKFNQGSVLMYFTRDLNYGNAK 394

  Fly   299 TDTCKLHLLKMHYCPNCNGHHSSSRSETKLCYGYCKNVMRGCSAEYAGLLDSPWSGVVDSLNNLV 363
            ....:....:...||..:  ..|..|||.      .|....||....|:|       .::.|.| 
 Worm   395 YKMFREIAQEYRTCPEKD--FISVDSETP------DNFDLDCSTSLKGIL-------CEANNTL- 443

  Fly   364 TTHILSDTGIINVIKHLQTYFSEAIMAAMHNGPELEKKVKKTCGTPSLTPYSSGEPDARPPPHKN 428
             :.::.|:.|.|.:........|.::.|:::..|:.:.:|......|:        :.....|.|
 Worm   444 -SFMMIDSKIENALAAKYGADREDMVVAINSKQEITRYIKSNITRESI--------NCLIRQHHN 499

  Fly   429 NVKWATDPDPGMVLFLSTIDKSKEFYTTIVDNFCDEQQHSRDDHSCWSGD----RFGDYT-QLLI 488
            :..            .|.:.:|.|..||       :.:..:|.|:...|:    :|.|.| :||:
 Worm   500 SAD------------NSFVTESTEIITT-------KTETPKDIHADAVGESSFVKFVDSTAELLL 545

  Fly   489 NPGTDSQRYNPEVPFNAKAQTGKLNELVDKLFKIRKSIGAAAPSNSIQATHDIQNDMGE 547
                                :.|:|.::     ....|..:|.|::|...|.:.|...|
 Worm   546 --------------------SRKINVIL-----FMGGIWHSASSSAIAPFHLVANHFKE 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dallyNP_001246685.1 Glypican 51..622 CDD:279494 81/449 (18%)
C03H12.1NP_510583.2 Thioredoxin_like 119..230 CDD:294274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10822
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.