DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13309 and CG34426

DIOPT Version :9

Sequence 1:NP_648262.2 Gene:CG13309 / 39012 FlyBaseID:FBgn0035933 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001097552.1 Gene:CG34426 / 5740622 FlyBaseID:FBgn0085455 Length:296 Species:Drosophila melanogaster


Alignment Length:294 Identity:80/294 - (27%)
Similarity:103/294 - (35%) Gaps:106/294 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AACNTCNANGVSCISETEFQFCSSASEPIGNLYTCPTGYYCTESTPICSS---------VASSAG 72
            |||..| .:..|||.|:|||.|..........||||      ||.|||::         .:...|
  Fly    17 AACGQC-VDAHSCIGESEFQLCYDGVRDQTINYTCP------ESKPICTTYGIICMPNGTSIERG 74

  Fly    73 C---TGCNTCSSDNRFACTGRNTFALCLGTSTPSTSIGGSCGTNYVCNVGNA------------- 121
            |   :.|..||....||||.|.|||:|.|....:.|.  .|..::||:|.||             
  Fly    75 CGDVSNCGVCSESTTFACTSRTTFAVCNGDVVSANSF--DCAEDFVCSVKNAASGSPCISRCDSS 137

  Fly   122 --NIC-----------------------------GSPATYAVSCSTSSTSDCD------------ 143
              :||                             ..|:|.....||.||.|..            
  Fly   138 DSDICDRVLEPEVESTTASVTPTVTSTVTPIETTADPSTVITDSSTGSTGDTSTGSSSVTSSDTS 202

  Fly   144 ------------------TTAIKNATEYCQTIQTAGKYPYGGDTSTTCRQYVNCYTAAGIFYGNV 190
                              ||...|...|||.|.:.|:||...|  |.|..|:.|...:|.:.|.:
  Fly   203 TDSTVTVTDSGSTTQSTATTPAFNEDTYCQEINSTGRYPIPND--TVCTSYIYCVLRSGSWAGLL 265

  Fly   191 YTC----PGLTYFDSTSKLCTT--QTQARCSDTV 218
            |.|    |   |||:....|.|  .:.|.|::.|
  Fly   266 YNCNVQRP---YFDADVFSCGTVKPSYAGCTNLV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13309NP_648262.2 None
CG34426NP_001097552.1 DUF1450 <66..116 CDD:299744 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.