DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13309 and CG13075

DIOPT Version :9

Sequence 1:NP_648262.2 Gene:CG13309 / 39012 FlyBaseID:FBgn0035933 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_648831.1 Gene:CG13075 / 39756 FlyBaseID:FBgn0036563 Length:339 Species:Drosophila melanogaster


Alignment Length:269 Identity:70/269 - (26%)
Similarity:105/269 - (39%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLLIVLGFYILGC------RAACNTC-NANGVSCISETEFQFCSSASEPIGNLYTCPTGYYCT 58
            |.|::.::.  |:.|      ..:|.|| ..|.|.|:.:..:|.|.. :.|:|::..||:|..|:
  Fly     1 MQRIIALVA--IMACGLSFVAAQSCQTCLEQNDVYCVDQNSYQNCMK-NGPVGDIIECPSGTVCS 62

  Fly    59 ESTPICS----------SVASSAGCTG--CNTCSSDNRFACTGRNTFALCLGTSTPSTSIGGSCG 111
            .|..:|:          .|...:|..|  |..|||..::||.....:|.|.......||...:||
  Fly    63 NSDSVCALISEVNSTILDVCGGSGGNGAQCEVCSSGAKYACVSSTQYARCSSAGDVLTSSVYNCG 127

  Fly   112 TNYVCNVGNANICGSPATYAVSCSTSSTSD-------CD--------TTAIKNATEYCQTIQTAG 161
            |:.:|      |..:.:||...|..|..|:       |.        ||.:...|    |...|.
  Fly   128 TDEIC------IIDALSTYQTVCVPSCASEFLGLDATCSNSIYQPTTTTTVAPTT----TPSAAQ 182

  Fly   162 KYPY--GGDTST-------------TCRQYVNCYTAAGIFYGNVYTCPGLT-YFDSTSKLCTTQT 210
            |...  .|:.||             ||..|:.|..:...:.....||...| :||||:..|.|..
  Fly   183 KEDLCNAGEPSTNPSYFFTRITDDSTCNSYLYCQKSGTTWVALYMTCGASTPFFDSTTSSCVTTR 247

  Fly   211 QARCSDTVS 219
            ...||||.:
  Fly   248 PTSCSDTTT 256



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.