DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13309 and CG33258

DIOPT Version :9

Sequence 1:NP_648262.2 Gene:CG13309 / 39012 FlyBaseID:FBgn0035933 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001034027.2 Gene:CG33258 / 3885664 FlyBaseID:FBgn0053258 Length:252 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:110/261 - (42%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLLIVLGFYILGCRAA----CNTC-NANGVSCISETEFQFCSSASEPIGNLYTCPTGYYCTES 60
            |.|.|::|.....|....    |..| ..|.|.|:.:|.::.|.. |:|.||:.:||....||.|
  Fly     1 MKRTLLILAIVFCGLAIVKALECQECLEDNDVYCVDQTSYRNCIK-SKPFGNVISCPDDTVCTNS 64

  Fly    61 TPIC---SSVASS----AGCTGCNTCS--SDNRFACTGRNTFALCLGTSTPSTSIGGSCGTNYVC 116
            ..:|   |.:|.|    .|.:|.|.|:  ::.::.|..:|.||.|..:....::| ..|.|:.:|
  Fly    65 KNVCVKSSDLAESEVDVCGTSGGNQCATCTNQKYTCVSKNQFARCSESVVVDSNI-YDCDTDEIC 128

  Fly   117 NVGNA-----NICGSPA------TYAVSCSTS---STSDCDTTAIKNATEY----CQTIQTAGKY 163
            : ..|     ||| :|:      ....:||.|   :|:....|.:..:||.    |...:...:.
  Fly   129 S-SEALEKYDNIC-TPSCVLDFLDVRATCSNSEYTTTTTAAPTTVTPSTEQKNSACTEAEKDLQI 191

  Fly   164 P---------YGGDTSTTCRQYVNCYTAAGIFYGNVY-TC----PGLTYFDSTSKLCTTQTQARC 214
            |         |..|||  |..|:.|.......:..|| :|    |   |||||:.||.:.....|
  Fly   192 PKETLYFFTIYKEDTS--CHTYLYCERTESTEWDTVYLSCHQPKP---YFDSTTSLCVSTKPTGC 251

  Fly   215 S 215
            |
  Fly   252 S 252



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.