| Sequence 1: | NP_648262.2 | Gene: | CG13309 / 39012 | FlyBaseID: | FBgn0035933 | Length: | 229 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_647782.1 | Gene: | CG14958 / 38387 | FlyBaseID: | FBgn0035413 | Length: | 145 | Species: | Drosophila melanogaster |
| Alignment Length: | 134 | Identity: | 49/134 - (36%) |
|---|---|---|---|
| Similarity: | 71/134 - (52%) | Gaps: | 6/134 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MLRLLIVLGFYILGCRAACNTCNANGVSCISETEFQFCSSASEPIGN-LYTCPTGYYCTESTPIC 64
Fly 65 ----SSVASSAGCTGCNTCSSDNRFACTGRNTFALCLGTSTPSTSIGGSCGTNYVCNVGNANICG 125
Fly 126 SPAT 129 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45471621 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2F9QR | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0005298 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.740 | |||||