DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13309 and CG32024

DIOPT Version :9

Sequence 1:NP_648262.2 Gene:CG13309 / 39012 FlyBaseID:FBgn0035933 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_729417.2 Gene:CG32024 / 317828 FlyBaseID:FBgn0052024 Length:209 Species:Drosophila melanogaster


Alignment Length:219 Identity:65/219 - (29%)
Similarity:106/219 - (48%) Gaps:18/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLLIVLGFYILGCRAACNTCNA-NGVSCISETEFQFCSSASEPIGNLYTCPTGYYCTESTPIC 64
            :|..:.:|...:...:|.||.|:: :.|:|:|:.::|.||:.:.|.|.:||||...:||.....|
  Fly     5 LLFSVFLLATLVKFSQAECNICSSESNVACVSKNQYQNCSANAIPTGTVYTCPNNTFCTGLPEKC 69

  Fly    65 SSVASSAGCTGCNTCSSDNRFACTGRNTFALCLGTSTPSTSIGGSCGTNYVC--NVGNANICGSP 127
            :|..:.|.|..|..|.....||||...|||||...:..::: ...|.|..||  .:||..: .||
  Fly    70 TSNEAFASCNDCRKCDGIIPFACTSPTTFALCNAVNEIASN-EYPCSTGEVCLYQIGNPCV-ASP 132

  Fly   128 ATYAVSCSTSSTSDCDTTAIKNATEYCQTIQTAGKYPYGGDTSTTCRQYVNCYTAAGIFYGNVYT 192
            ...:.|||..:..|          :.|....:.|::||..|.|  |.:|:.|:..:..:.||.:.
  Fly   133 NGTSASCSQYALID----------DLCIQKSSTGRFPYPNDLS--CLKYIYCFRKSSTWSGNSWQ 185

  Fly   193 CP-GLTYFDSTSKLCTTQTQARCS 215
            || ...||.:::..|.....|.|:
  Fly   186 CPSSKPYFSASTSTCVATKPATCA 209



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.