DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13312 and Gasp

DIOPT Version :10

Sequence 1:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:161 Identity:35/161 - (21%)
Similarity:57/161 - (35%) Gaps:36/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 AAVQSQGKYAVGYNAY---TTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSA-----SEMCVSTMP 241
            |..||..|....:..|   |:|.:|..|    .:.:.:..||...:.||:.     :|.|.....
  Fly    15 AVAQSSFKCPDDFGFYPHDTSCDKYWKC----DNGVSELKTCGNGLAFDATDSKYLTENCDYLHN 75

  Fly   242 STCSTTATTSSTTTAAPTTSNPEAYCQAMQSAGYYPVGTDASTTCHQYIDCFLNGGTWGG--NMY 304
            ..|      ...|...|..:.|  :|..:.  |.:|    ....|..:.:|      |.|  :.|
  Fly    76 VDC------GDRTELEPPITTP--HCSRLY--GIFP----DENKCDVFWNC------WNGEPSRY 120

  Fly   305 TCPGSLYYNSASRTCV--STLPSTCSTTVAS 333
            .|...|.|:..:|.|:  ..:|...:..||:
  Fly   121 QCSPGLAYDRDARVCMWADQVPECKNEEVAN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13312NP_648260.1 None
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 12/54 (22%)
CBM_14 97..144 CDD:426342 13/58 (22%)
CBM_14 170..218 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.